Recombinant Human NRTN protein
| Cat.No. : | NRTN-29535TH |
| Product Overview : | Recombinant Human NRTN protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 102 |
| Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. A neurturin mutation has been described in a family with Hirschsprung Disease. |
| Form : | Lyophilized from a 0.2μm filtered concentrated solution in 30 mM Citrate Sodium, pH 4.2, 400 mM NaCl, with 0.02 % Tween-20. |
| Bio-activity : | Fully biologically active when compared to standard. The biologically active as determined by its binding ability in a functional ELISA. |
| Molecular Mass : | Approximately 23.4 kDa, a homodimeric protein consisting of two 102 amino acid non-glycosylated polypeptide chains. |
| AA Sequence : | ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV |
| Endotoxin : | Less than 1 EU/μg of rHuNeurturin as determined by LAL method. |
| Purity : | >96% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 0.5 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | NRTN |
| Official Symbol | NRTN |
| Synonyms | NRTN; neurturin; NTN; |
| Gene ID | 4902 |
| mRNA Refseq | NM_004558 |
| Protein Refseq | NP_004549 |
| MIM | 602018 |
| UniProt ID | Q99748 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRTN Products
Required fields are marked with *
My Review for All NRTN Products
Required fields are marked with *
