Recombinant Human NRTN protein

Cat.No. : NRTN-29535TH
Product Overview : Recombinant Human NRTN protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 102
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. A neurturin mutation has been described in a family with Hirschsprung Disease.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 30 mM Citrate Sodium, pH 4.2, 400 mM NaCl, with 0.02 % Tween-20.
Bio-activity : Fully biologically active when compared to standard. The biologically active as determined by its binding ability in a functional ELISA.
Molecular Mass : Approximately 23.4 kDa, a homodimeric protein consisting of two 102 amino acid non-glycosylated polypeptide chains.
AA Sequence : ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV
Endotoxin : Less than 1 EU/μg of rHuNeurturin as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 0.5 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name NRTN
Official Symbol NRTN
Synonyms NRTN; neurturin; NTN;
Gene ID 4902
mRNA Refseq NM_004558
Protein Refseq NP_004549
MIM 602018
UniProt ID Q99748

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRTN Products

Required fields are marked with *

My Review for All NRTN Products

Required fields are marked with *

0
cart-icon