Recombinant Human P2RY12 Full Length Transmembrane protein, His-tagged

Cat.No. : P2RY12-2459H
Product Overview : Recombinant Human P2RY12 protein(Q9H244)(1-342aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-342aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 42.2 kDa
AA Sequence : MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name P2RY12 purinergic receptor P2Y, G-protein coupled, 12 [ Homo sapiens ]
Official Symbol P2RY12
Synonyms P2RY12; purinergic receptor P2Y, G-protein coupled, 12; P2Y purinoceptor 12; HORK3; P2Y12; SP1999; ADP-glucose receptor; purinergic receptor P2RY12; P2Y12 platelet ADP receptor; Gi-coupled ADP receptor HORK3; G-protein coupled receptor SP1999; putative G-protein coupled receptor; ADPG-R; BDPLT8; P2T(AC); P2Y(AC); P2Y(ADP); P2Y(cyc);
Gene ID 64805
mRNA Refseq NM_022788
Protein Refseq NP_073625
MIM 600515
UniProt ID Q9H244

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All P2RY12 Products

Required fields are marked with *

My Review for All P2RY12 Products

Required fields are marked with *

0
cart-icon
0
compare icon