Recombinant Human P2RY12 Full Length Transmembrane protein, His-tagged
Cat.No. : | P2RY12-2459H |
Product Overview : | Recombinant Human P2RY12 protein(Q9H244)(1-342aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-342aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.2 kDa |
AA Sequence : | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | P2RY12 purinergic receptor P2Y, G-protein coupled, 12 [ Homo sapiens ] |
Official Symbol | P2RY12 |
Synonyms | P2RY12; purinergic receptor P2Y, G-protein coupled, 12; P2Y purinoceptor 12; HORK3; P2Y12; SP1999; ADP-glucose receptor; purinergic receptor P2RY12; P2Y12 platelet ADP receptor; Gi-coupled ADP receptor HORK3; G-protein coupled receptor SP1999; putative G-protein coupled receptor; ADPG-R; BDPLT8; P2T(AC); P2Y(AC); P2Y(ADP); P2Y(cyc); |
Gene ID | 64805 |
mRNA Refseq | NM_022788 |
Protein Refseq | NP_073625 |
MIM | 600515 |
UniProt ID | Q9H244 |
◆ Cell & Tissue Lysates | ||
P2RY12-3491HCL | Recombinant Human P2RY12 293 Cell Lysate | +Inquiry |
P2RY12-3492HCL | Recombinant Human P2RY12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All P2RY12 Products
Required fields are marked with *
My Review for All P2RY12 Products
Required fields are marked with *