Recombinant Human P2RY12 Full Length Transmembrane protein, His-tagged

• Cat.No.: P2RY12-2459H
• Product Overview: Recombinant Human P2RY12 protein(Q9H244)(1-342aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-342aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.2 kDa
• AA Sequence: MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: P2RY12 purinergic receptor P2Y, G-protein coupled, 12 [ Homo sapiens ]
• Official Symbol: P2RY12
• Synonyms: P2RY12; purinergic receptor P2Y, G-protein coupled, 12; P2Y purinoceptor 12; HORK3; P2Y12; SP1999; ADP-glucose receptor; purinergic receptor P2RY12; P2Y12 platelet ADP receptor; Gi-coupled ADP receptor HORK3; G-protein coupled receptor SP1999; putative G-protein coupled receptor; ADPG-R; BDPLT8; P2T(AC); P2Y(AC); P2Y(ADP); P2Y(cyc)
• Gene ID: 64805
• mRNA Refseq: NM_022788
• Protein Refseq: NP_073625
• MIM: 600515
• UniProt ID: Q9H244