Recombinant Human PAX7 protein, T7/His-tagged
| Cat.No. : | PAX7-132H |
| Product Overview : | Recombinant human Pax7 cDNA (520aa, Isoform_1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFAALPGTVPRMMRPAPGQNYPRTGFPLEVSTPLGQGRVNQLGGVFIN GRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPRQVATPDVEKKIEEYK RENPGMFSWEIRDRLLKDGHCDRSTVPSGLVSSISRVLRIKFGKKEEEDEADKKEDDGEKKAKHSIDGILGDKGN RLDEGSDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFSNRRARW RKQAGANQLAAFNHLLPGGFPPTGMPTLPPYQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAAAAAAAD TSSAYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISAS CSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKV VSGWGMSISQMEKLKSSQMEQFT |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Publications : |
DNA aptamers against the DUX4 protein reveal novel therapeutic implications for FSHD (2020)
|
| Gene Name | PAX7 paired box 7 [ Homo sapiens ] |
| Official Symbol | PAX7 |
| Synonyms | PAX7; paired box 7; paired box gene 7; paired box protein Pax-7; Hup1; paired domain gene 7; paired box homeotic gene 7; PAX7 transcriptional factor; HUP1; RMS2; PAX7B; FLJ37460; |
| Gene ID | 5081 |
| mRNA Refseq | NM_001135254 |
| Protein Refseq | NP_001128726 |
| MIM | 167410 |
| UniProt ID | P23759 |
| Chromosome Location | 1p36.13 |
| Pathway | Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
| Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| PAX7-132H | Recombinant Human PAX7 protein, T7/His-tagged | +Inquiry |
| PAX7-6622C | Recombinant Chicken PAX7 | +Inquiry |
| PAX7-29057TH | Recombinant Human PAX7 | +Inquiry |
| PAX7-2924H | Recombinant Human PAX7 protein, His-tagged | +Inquiry |
| PAX7-6754H | Recombinant Human PAX7 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PAX7-3414HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
| PAX7-3413HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAX7 Products
Required fields are marked with *
My Review for All PAX7 Products
Required fields are marked with *
