Recombinant Human PDGFA protein, GST-tagged
Cat.No. : | PDGFA-1608H |
Product Overview : | Recombinant human PDGFA protein (135-196 aa) with a GST tag was expressed in E. coli. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 135-196 a.a. |
Description : | This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit A, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit B. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. |
Form : | Powder |
AA Sequence : | TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Storage Buffer : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μL in 200 μL sterile water for short-term storage. Reconstitution with 200 μL 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | PDGFA platelet derived growth factor subunit A [ Homo sapiens (human) ] |
Official Symbol | PDGFA |
Synonyms | PDGFA; platelet derived growth factor subunit A; PDGF1; PDGF-A; platelet-derived growth factor subunit A; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A-chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha polypeptide |
Gene ID | 5154 |
mRNA Refseq | NM_002607 |
Protein Refseq | NP_002598 |
MIM | 173430 |
UniProt ID | P04085 |
◆ Recombinant Proteins | ||
Pdgfa-2732R | Recombinant Rat Pdgfa protein, His & T7-tagged | +Inquiry |
PDGFA-375H | Active Recombinant Human Platelet-derived Growth Factor AA | +Inquiry |
Pdgfa-4754M | Active Recombinant Mouse Pdgfa Protein | +Inquiry |
PDGFA-514M | Recombinant Mouse PDGFA protein(Ser87-Arg196), His-tagged | +Inquiry |
PDGFA-093H | Active Recombinant Human PDGFA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFA-3337HCL | Recombinant Human PDGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDGFA Products
Required fields are marked with *
My Review for All PDGFA Products
Required fields are marked with *
0
Inquiry Basket