Recombinant Human PDGFA protein, GST-tagged

Cat.No. : PDGFA-1608H
Product Overview : Recombinant human PDGFA protein (135-196 aa) with a GST tag was expressed in E. coli.
Availability October 19, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 135-196 a.a.
Description : This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit A, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit B. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes.
Form : Powder
AA Sequence : TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Storage Buffer : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μL in 200 μL sterile water for short-term storage.
Reconstitution with 200 μL 50% glycerol solution is recommended for longer term storage.
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name PDGFA platelet derived growth factor subunit A [ Homo sapiens (human) ]
Official Symbol PDGFA
Synonyms PDGFA; platelet derived growth factor subunit A; PDGF1; PDGF-A; platelet-derived growth factor subunit A; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A-chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha polypeptide
Gene ID 5154
mRNA Refseq NM_002607
Protein Refseq NP_002598
MIM 173430
UniProt ID P04085

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDGFA Products

Required fields are marked with *

My Review for All PDGFA Products

Required fields are marked with *

0
cart-icon
0
compare icon