Recombinant Human PDGFC Protein, His tagged

Cat.No. : PDGFC-001H
Product Overview : Recombinant Human PDGFC protein (230-345 aa) with His tag was expressed in E. coli.
Availability July 23, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 230-345 aa
Description : The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product appears to form only homodimers. It differs from the platelet-derived growth factor alpha and beta polypeptides in having an unusual N-terminal domain, the CUB domain. Alternatively spliced transcript variants have been found for this gene.
Molecular Mass : 14 kDa
AA Sequence : MGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGGHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 0.1 % SKL
Concentration : 1 mg/mL by BCA
Gene Name PDGFC platelet derived growth factor C [ Homo sapiens (human) ]
Official Symbol PDGFC
Synonyms PDGFC; platelet derived growth factor C; platelet-derived growth factor C; fallotein; SCDGF; PDGF-C; VEGF-E; spinal cord-derived growth factor; secretory growth factor-like protein; FALLOTEIN
Gene ID 56034
mRNA Refseq NM_016205
Protein Refseq NP_057289
MIM 608452
UniProt ID Q9NRA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDGFC Products

Required fields are marked with *

My Review for All PDGFC Products

Required fields are marked with *

0
cart-icon