Recombinant Human PDGFC Protein, His tagged
| Cat.No. : | PDGFC-001H |
| Product Overview : | Recombinant Human PDGFC protein (230-345 aa) with His tag was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 230-345 aa |
| Description : | The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product appears to form only homodimers. It differs from the platelet-derived growth factor alpha and beta polypeptides in having an unusual N-terminal domain, the CUB domain. Alternatively spliced transcript variants have been found for this gene. |
| Molecular Mass : | 14 kDa |
| AA Sequence : | MGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGGHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL. |
| Purity : | > 90 % by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 0.1 % SKL |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | PDGFC platelet derived growth factor C [ Homo sapiens (human) ] |
| Official Symbol | PDGFC |
| Synonyms | PDGFC; platelet derived growth factor C; platelet-derived growth factor C; fallotein; SCDGF; PDGF-C; VEGF-E; spinal cord-derived growth factor; secretory growth factor-like protein; FALLOTEIN |
| Gene ID | 56034 |
| mRNA Refseq | NM_016205 |
| Protein Refseq | NP_057289 |
| MIM | 608452 |
| UniProt ID | Q9NRA1 |
| ◆ Recombinant Proteins | ||
| PDGFC-096H | Active Recombinant Human PDGFC Protein | +Inquiry |
| PDGFC-888H | Recombinant Human PDGFC | +Inquiry |
| PDGFC-699H | Active Recombinant Human PDGFC Protein, Met & His-tagged | +Inquiry |
| Pdgfc-873M | Active Recombinant Mouse Pdgfc protein(Val235-Gly345), hFc-tagged | +Inquiry |
| PDGFC-517H | Recombinant Human PDGFC Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDGFC-1836MCL | Recombinant Mouse PDGFC cell lysate | +Inquiry |
| PDGFC-2872HCL | Recombinant Human PDGFC cell lysate | +Inquiry |
| PDGFC-429HCL | Recombinant Human PDGFC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFC Products
Required fields are marked with *
My Review for All PDGFC Products
Required fields are marked with *
