Recombinant Human PDGFC Protein, His tagged
Cat.No. : | PDGFC-001H |
Product Overview : | Recombinant Human PDGFC protein (230-345 aa) with His tag was expressed in E. coli. |
Availability | August 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 230-345 aa |
Description : | The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product appears to form only homodimers. It differs from the platelet-derived growth factor alpha and beta polypeptides in having an unusual N-terminal domain, the CUB domain. Alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | 14 kDa |
AA Sequence : | MGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGGHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 0.1 % SKL |
Concentration : | 1 mg/mL by BCA |
Gene Name | PDGFC platelet derived growth factor C [ Homo sapiens (human) ] |
Official Symbol | PDGFC |
Synonyms | PDGFC; platelet derived growth factor C; platelet-derived growth factor C; fallotein; SCDGF; PDGF-C; VEGF-E; spinal cord-derived growth factor; secretory growth factor-like protein; FALLOTEIN |
Gene ID | 56034 |
mRNA Refseq | NM_016205 |
Protein Refseq | NP_057289 |
MIM | 608452 |
UniProt ID | Q9NRA1 |
◆ Recombinant Proteins | ||
PDGFC-096H | Active Recombinant Human PDGFC Protein | +Inquiry |
PDGFC-206H | Active Recombinant Human PDGFC protein(Val235-Gly345), hFc-tagged | +Inquiry |
PDGFC-208H | Active Recombinant Human PDGFC, His-tagged | +Inquiry |
PDGFC-888H | Recombinant Human PDGFC | +Inquiry |
PDGFC-699H | Active Recombinant Human PDGFC Protein, Met & His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFC-429HCL | Recombinant Human PDGFC cell lysate | +Inquiry |
PDGFC-2872HCL | Recombinant Human PDGFC cell lysate | +Inquiry |
PDGFC-1836MCL | Recombinant Mouse PDGFC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFC Products
Required fields are marked with *
My Review for All PDGFC Products
Required fields are marked with *