Recombinant Human PFN1 protein, T7/His-tagged

• Cat.No.: PFN1-115H
• Product Overview: Recombinant human PFN1 cDNA (2 – 140 aa) fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 2-140 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAE VGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGG LINKKCYEMASHLRRSQY
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: PFN1 profilin 1 [ Homo sapiens ]
• Official Symbol: PFN1
• Synonyms: PFN1; profilin 1; profilin-1; profilin I
• Gene ID: 5216
• mRNA Refseq: NM_005022
• Protein Refseq: NP_005013
• MIM: 176610
• UniProt ID: P07737
• Chromosome Location: 17p13.2
• Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem; Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Regulation of Actin Cytoskeleton, organism-specific biosystem
• Function: Rho GTPase binding; actin binding; phosphatidylinositol-4,5-bisphosphate binding; proline-rich region binding; receptor binding