Recombinant Human PFN1 protein, T7/His-tagged

Cat.No. : PFN1-115H
Product Overview : Recombinant human PFN1 cDNA (2 – 140 aa) fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-140 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAE VGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGG LINKKCYEMASHLRRSQY
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name PFN1 profilin 1 [ Homo sapiens ]
Official Symbol PFN1
Synonyms PFN1; profilin 1; profilin-1; profilin I;
Gene ID 5216
mRNA Refseq NM_005022
Protein Refseq NP_005013
MIM 176610
UniProt ID P07737
Chromosome Location 17p13.2
Pathway Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem; Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Regulation of Actin Cytoskeleton, organism-specific biosystem;
Function Rho GTPase binding; actin binding; phosphatidylinositol-4,5-bisphosphate binding; proline-rich region binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PFN1 Products

Required fields are marked with *

My Review for All PFN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon