Recombinant Human PHGDH protein, His-tagged
Cat.No. : | PHGDH-3530H |
Product Overview : | Recombinant Human PHGDH protein(185-533 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 185-533 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PHGDH phosphoglycerate dehydrogenase [ Homo sapiens ] |
Official Symbol | PHGDH |
Synonyms | PHGDH; phosphoglycerate dehydrogenase; D-3-phosphoglycerate dehydrogenase; PDG; PGDH; SERA; 3-phosphoglycerate dehydrogenase; PGD; PGAD; 3PGDH; 3-PGDH; MGC3017; |
Gene ID | 26227 |
mRNA Refseq | NM_006623 |
Protein Refseq | NP_006614 |
MIM | 606879 |
UniProt ID | O43175 |
◆ Recombinant Proteins | ||
Phgdh-4837M | Recombinant Mouse Phgdh Protein, Myc/DDK-tagged | +Inquiry |
PHGDH-3530H | Recombinant Human PHGDH protein, His-tagged | +Inquiry |
PHGDH-477H | Recombinant Human PHGDH Protein, His-tagged | +Inquiry |
PHGDH-478H | Recombinant Human PHGDH Protein, DDK-tagged | +Inquiry |
PHGDH-851H | Recombinant Human PHGDH, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHGDH-3223HCL | Recombinant Human PHGDH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PHGDH Products
Required fields are marked with *
My Review for All PHGDH Products
Required fields are marked with *
0
Inquiry Basket