Recombinant Human PHGDH protein, His-tagged
| Cat.No. : | PHGDH-3530H |
| Product Overview : | Recombinant Human PHGDH protein(185-533 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | January 30, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 185-533 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | SFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PHGDH phosphoglycerate dehydrogenase [ Homo sapiens ] |
| Official Symbol | PHGDH |
| Synonyms | PHGDH; phosphoglycerate dehydrogenase; D-3-phosphoglycerate dehydrogenase; PDG; PGDH; SERA; 3-phosphoglycerate dehydrogenase; PGD; PGAD; 3PGDH; 3-PGDH; MGC3017; |
| Gene ID | 26227 |
| mRNA Refseq | NM_006623 |
| Protein Refseq | NP_006614 |
| MIM | 606879 |
| UniProt ID | O43175 |
| ◆ Recombinant Proteins | ||
| PHGDH-1682H | Recombinant Human PHGDH, GST-tagged | +Inquiry |
| PHGDH-6696M | Recombinant Mouse PHGDH Protein, His (Fc)-Avi-tagged | +Inquiry |
| PHGDH-1414HFL | Recombinant Full Length Human PHGDH Protein, C-Flag-tagged | +Inquiry |
| PHGDH-0276H | Recombinant Human PHGDH Protein (A4-V315), Tag Free | +Inquiry |
| PHGDH-1668H | Recombinant Human PHGDH Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PHGDH-3223HCL | Recombinant Human PHGDH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHGDH Products
Required fields are marked with *
My Review for All PHGDH Products
Required fields are marked with *
