Recombinant Human PLAUR Protein (23-305 aa), GST-tagged
| Cat.No. : | PLAUR-725H |
| Product Overview : | Recombinant Human PLAUR Protein (23-305 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein. |
| Availability | August 24, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 23-305 aa |
| Description : | Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 58.5 kDa |
| AA Sequence : | LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | PLAUR plasminogen activator, urokinase receptor [ Homo sapiens ] |
| Official Symbol | PLAUR |
| Synonyms | PLAUR; CD87; UPAR; URKR; U-PAR; |
| Gene ID | 5329 |
| mRNA Refseq | NM_001005376 |
| Protein Refseq | NP_001005376 |
| MIM | 173391 |
| UniProt ID | Q03405 |
| ◆ Recombinant Proteins | ||
| PLAUR-392H | Active Recombinant Human PLAUR protein, His-tagged | +Inquiry |
| PLAUR-1488R | Recombinant Rat PLAUR Protein (25-299 aa), His-tagged | +Inquiry |
| Plaur-2304M | Active Recombinant Mouse Plaur protein(Met1-Thr297), His-tagged | +Inquiry |
| PLAUR-585H | Recombinant Human PLAUR protein, His & GST-tagged | +Inquiry |
| PLAUR-2607H | Recombinant Human PLAUR Protein (Leu23-Arg30), His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLAUR-1888HCL | Recombinant Human PLAUR cell lysate | +Inquiry |
| PLAUR-2551MCL | Recombinant Mouse PLAUR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAUR Products
Required fields are marked with *
My Review for All PLAUR Products
Required fields are marked with *



