Recombinant Human PLAUR Protein (23-305 aa), GST-tagged
Cat.No. : | PLAUR-725H |
Product Overview : | Recombinant Human PLAUR Protein (23-305 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein. |
Availability | July 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 23-305 aa |
Description : | Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 58.5 kDa |
AA Sequence : | LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | PLAUR plasminogen activator, urokinase receptor [ Homo sapiens ] |
Official Symbol | PLAUR |
Synonyms | PLAUR; CD87; UPAR; URKR; U-PAR; |
Gene ID | 5329 |
mRNA Refseq | NM_001005376 |
Protein Refseq | NP_001005376 |
MIM | 173391 |
UniProt ID | Q03405 |
◆ Recombinant Proteins | ||
PLAUR-1289H | Recombinant Human PLAUR Protein (Leu23-Arg303), N-His tagged | +Inquiry |
PLAUR-3942H | Recombinant Human PLAUR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PLAUR-1866H | Recombinant Human PLAUR Protein, MYC/DDK-tagged | +Inquiry |
Plaur-587R | Recombinant Rat Plaur protein, His-tagged | +Inquiry |
PLAUR-1569H | Recombinant Human PLAUR protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAUR-1888HCL | Recombinant Human PLAUR cell lysate | +Inquiry |
PLAUR-2551MCL | Recombinant Mouse PLAUR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAUR Products
Required fields are marked with *
My Review for All PLAUR Products
Required fields are marked with *