Recombinant Human POLA1
Cat.No. : | POLA1-28359TH |
Product Overview : | Recombinant fragment of Human DNA polymerase alpha (aa 1363-1462) with a N terminal proprietary tag: predicted molecular weight 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes the catalytic subunit of DNA polymerase, which together with a regulatory and two primase subunits, forms the DNA polymerase alpha complex. The catalytic subunit plays an essential role in the initiation of DNA replication. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS |
Sequence Similarities : | Belongs to the DNA polymerase type-B family. |
Gene Name | POLA1 polymerase (DNA directed), alpha 1, catalytic subunit [ Homo sapiens ] |
Official Symbol | POLA1 |
Synonyms | POLA1; polymerase (DNA directed), alpha 1, catalytic subunit; POLA, polymerase (DNA directed), alpha , polymerase (DNA directed), alpha 1; DNA polymerase alpha catalytic subunit; p180; |
Gene ID | 5422 |
mRNA Refseq | NM_016937 |
Protein Refseq | NP_058633 |
MIM | 312040 |
Uniprot ID | P09884 |
Chromosome Location | Xp22.1-p21.3 |
Pathway | Activation of the pre-replicative complex, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Replication, organism-specific biosystem; DNA Replication, organism-specific biosystem; |
Function | DNA binding; DNA binding; contributes_to DNA primase activity; DNA-directed DNA polymerase activity; DNA-directed DNA polymerase activity; |
◆ Recombinant Proteins | ||
POLA1-8020H | Recombinant Human POLA1 protein, His & T7-tagged | +Inquiry |
POLA1-4560R | Recombinant Rat POLA1 Protein | +Inquiry |
POLA-938H | Recombinant Human POLA1 protein | +Inquiry |
POLA1-4220R | Recombinant Rat POLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
POLA1-4949H | Recombinant Human POLA1 Protein (Gly1240-Ser1462), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLA1 Products
Required fields are marked with *
My Review for All POLA1 Products
Required fields are marked with *