Recombinant Human POLA1

Cat.No. : POLA1-28359TH
Product Overview : Recombinant fragment of Human DNA polymerase alpha (aa 1363-1462) with a N terminal proprietary tag: predicted molecular weight 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes the catalytic subunit of DNA polymerase, which together with a regulatory and two primase subunits, forms the DNA polymerase alpha complex. The catalytic subunit plays an essential role in the initiation of DNA replication.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS
Sequence Similarities : Belongs to the DNA polymerase type-B family.
Gene Name POLA1 polymerase (DNA directed), alpha 1, catalytic subunit [ Homo sapiens ]
Official Symbol POLA1
Synonyms POLA1; polymerase (DNA directed), alpha 1, catalytic subunit; POLA, polymerase (DNA directed), alpha , polymerase (DNA directed), alpha 1; DNA polymerase alpha catalytic subunit; p180;
Gene ID 5422
mRNA Refseq NM_016937
Protein Refseq NP_058633
MIM 312040
Uniprot ID P09884
Chromosome Location Xp22.1-p21.3
Pathway Activation of the pre-replicative complex, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Replication, organism-specific biosystem; DNA Replication, organism-specific biosystem;
Function DNA binding; DNA binding; contributes_to DNA primase activity; DNA-directed DNA polymerase activity; DNA-directed DNA polymerase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLA1 Products

Required fields are marked with *

My Review for All POLA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon