Recombinant Human PRAME Protein, Tag Free
Cat.No. : | PRAME-01H |
Product Overview : | Recombinant Human PRAME Protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Protein Length : | 100-509 aa |
Description : | This gene encodes an antigen that is preferentially expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. The encoded protein acts as a repressor of retinoic acid receptor, and likely confers a growth advantage to cancer cells via this function. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 47 kDa |
AA Sequence : | VLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISISALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPHCGDRTFYDPEPILCPCFMPN |
Endotoxin : | <1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 5% Glycerol, 0.1% SKL |
Concentration : | 0.26 mg/mL by BCA |
Gene Name | PRAME preferentially expressed antigen in melanoma [ Homo sapiens (human) ] |
Official Symbol | PRAME |
Synonyms | PRAME; preferentially expressed antigen in melanoma; MAPE; melanoma antigen preferentially expressed in tumors; cancer/testis antigen 130; CT130; OIP-4; opa-interacting protein 4; Opa-interacting protein OIP4; preferentially expressed antigen of melanoma; OIP4 |
Gene ID | 23532 |
mRNA Refseq | NM_006115 |
Protein Refseq | NP_006106 |
MIM | 606021 |
UniProt ID | P78395 |
◆ Recombinant Proteins | ||
PRAME-3368H | Recombinant Human PRAME protein, His-tagged | +Inquiry |
PRAME-1492H | Recombinant Human PRAME Protein (1-509 aa), His-tagged | +Inquiry |
PRAME-252HFL | Recombinant Full Length Human PRAME Protein, C-Flag-tagged | +Inquiry |
PRAME-2874H | Recombinant Human PRAME Protein, His-tagged | +Inquiry |
PRAME-1754H | Recombinant Human PRAME Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PRAME-01HB | Recombinant Human PRAME Protein, Tag Free, Biotinylated | +Inquiry |
PRAME-01H | Recombinant Human PRAME Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRAME-2896HCL | Recombinant Human PRAME 293 Cell Lysate | +Inquiry |
PRAME-2897HCL | Recombinant Human PRAME 293 Cell Lysate | +Inquiry |
PRAME-2895HCL | Recombinant Human PRAME 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRAME Products
Required fields are marked with *
My Review for All PRAME Products
Required fields are marked with *
0
Inquiry Basket