Recombinant Human PRAME Protein, Tag Free, Biotinylated
| Cat.No. : | PRAME-01HB |
| Product Overview : | Biotinylated recombinant Human PRAME Protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Non |
| Protein Length : | 100-509 aa |
| Conjugation/Label : | Biotin |
| Description : | This gene encodes an antigen that is preferentially expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. The encoded protein acts as a repressor of retinoic acid receptor, and likely confers a growth advantage to cancer cells via this function. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 47 kDa |
| AA Sequence : | VLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISISALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPHCGDRTFYDPEPILCPCFMPN |
| Endotoxin : | <1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 5% Glycerol, 0.1% SKL |
| Concentration : | 0.19 mg/mL by BCA |
| Conjugation : | Biotin |
| Gene Name | PRAME preferentially expressed antigen in melanoma [ Homo sapiens (human) ] |
| Official Symbol | PRAME |
| Synonyms | PRAME; preferentially expressed antigen in melanoma; MAPE; melanoma antigen preferentially expressed in tumors; cancer/testis antigen 130; CT130; OIP-4; opa-interacting protein 4; Opa-interacting protein OIP4; preferentially expressed antigen of melanoma; OIP4 |
| Gene ID | 23532 |
| mRNA Refseq | NM_006115 |
| Protein Refseq | NP_006106 |
| MIM | 606021 |
| UniProt ID | P78395 |
| ◆ Recombinant Proteins | ||
| PRAME-1474H | Recombinant Human PRAME Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PRAME-1492H | Recombinant Human PRAME Protein (1-509 aa), His-tagged | +Inquiry |
| PRAME-252HFL | Recombinant Full Length Human PRAME Protein, C-Flag-tagged | +Inquiry |
| PRAME-01H | Recombinant Human PRAME Protein | +Inquiry |
| PRAME-724H | Recombinant Human PRAME Protein, His/GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRAME-2897HCL | Recombinant Human PRAME 293 Cell Lysate | +Inquiry |
| PRAME-2896HCL | Recombinant Human PRAME 293 Cell Lysate | +Inquiry |
| PRAME-2895HCL | Recombinant Human PRAME 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRAME Products
Required fields are marked with *
My Review for All PRAME Products
Required fields are marked with *
