Recombinant Human PRAME Protein, Tag Free, Biotinylated

Cat.No. : PRAME-01HB
Product Overview : Biotinylated recombinant Human PRAME Protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Non
Protein Length : 100-509 aa
Conjugation/Label : Biotin
Description : This gene encodes an antigen that is preferentially expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. The encoded protein acts as a repressor of retinoic acid receptor, and likely confers a growth advantage to cancer cells via this function. Alternative splicing results in multiple transcript variants.
Molecular Mass : 47 kDa
AA Sequence : VLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISISALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPHCGDRTFYDPEPILCPCFMPN
Endotoxin : <1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 5% Glycerol, 0.1% SKL
Concentration : 0.19 mg/mL by BCA
Conjugation : Biotin
Gene Name PRAME preferentially expressed antigen in melanoma [ Homo sapiens (human) ]
Official Symbol PRAME
Synonyms PRAME; preferentially expressed antigen in melanoma; MAPE; melanoma antigen preferentially expressed in tumors; cancer/testis antigen 130; CT130; OIP-4; opa-interacting protein 4; Opa-interacting protein OIP4; preferentially expressed antigen of melanoma; OIP4
Gene ID 23532
mRNA Refseq NM_006115
Protein Refseq NP_006106
MIM 606021
UniProt ID P78395

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRAME Products

Required fields are marked with *

My Review for All PRAME Products

Required fields are marked with *

0
cart-icon