Recombinant Human PRAME Protein, Tag Free, Biotinylated

• Cat.No.: PRAME-01HB
• Product Overview: Biotinylated recombinant Human PRAME Protein without tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Non
• Protein Length: 100-509 aa
• Conjugation/Label: Biotin
• Description: This gene encodes an antigen that is preferentially expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. The encoded protein acts as a repressor of retinoic acid receptor, and likely confers a growth advantage to cancer cells via this function. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 47 kDa
• AA Sequence: VLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISISALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPHCGDRTFYDPEPILCPCFMPN
• Endotoxin: <1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 5% Glycerol, 0.1% SKL
• Concentration: 0.19 mg/mL by BCA
• Conjugation: Biotin

Gene Information

• Gene Name: PRAME preferentially expressed antigen in melanoma [ Homo sapiens (human) ]
• Official Symbol: PRAME
• Synonyms: PRAME; preferentially expressed antigen in melanoma; MAPE; melanoma antigen preferentially expressed in tumors; cancer/testis antigen 130; CT130; OIP-4; opa-interacting protein 4; Opa-interacting protein OIP4; preferentially expressed antigen of melanoma; OIP4
• Gene ID: 23532
• mRNA Refseq: NM_006115
• Protein Refseq: NP_006106
• MIM: 606021
• UniProt ID: P78395