Recombinant Human PTPN6 protein, GST-tagged

• Cat.No.: PTPN6-7875H
• Product Overview: Recombinant Human PTPN6 protein(506-598 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 506-598 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: QYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: PTPN6 protein tyrosine phosphatase, non-receptor type 6 [ Homo sapiens ]
• Official Symbol: PTPN6
• Synonyms: PTPN6; protein tyrosine phosphatase, non-receptor type 6; tyrosine-protein phosphatase non-receptor type 6; HCP; HCPH; PTP 1C; SHP 1; SHP1; hematopoietic cell phosphatase; protein-tyrosine phosphatase 1C; protein-tyrosine phosphatase SHP-1; hematopoietic cell protein-tyrosine phosphatase; SHP-1; HPTP1C; PTP-1C; SHP-1L; SH-PTP1
• Gene ID: 5777
• mRNA Refseq: NM_002831
• Protein Refseq: NP_002822
• MIM: 176883
• UniProt ID: P29350