Recombinant Human PTPN6 protein, GST-tagged
Cat.No. : | PTPN6-7875H |
Product Overview : | Recombinant Human PTPN6 protein(506-598 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 506-598 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | QYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PTPN6 protein tyrosine phosphatase, non-receptor type 6 [ Homo sapiens ] |
Official Symbol | PTPN6 |
Synonyms | PTPN6; protein tyrosine phosphatase, non-receptor type 6; tyrosine-protein phosphatase non-receptor type 6; HCP; HCPH; PTP 1C; SHP 1; SHP1; hematopoietic cell phosphatase; protein-tyrosine phosphatase 1C; protein-tyrosine phosphatase SHP-1; hematopoietic cell protein-tyrosine phosphatase; SHP-1; HPTP1C; PTP-1C; SHP-1L; SH-PTP1; |
Gene ID | 5777 |
mRNA Refseq | NM_002831 |
Protein Refseq | NP_002822 |
MIM | 176883 |
UniProt ID | P29350 |
◆ Recombinant Proteins | ||
PTPN6-0698H | Recombinant Full Length Human PTPN6 Protein (M1-K595), His/Strep tagged | +Inquiry |
PTPN6-5522H | Recombinant Human PTPN6 protein, His-tagged | +Inquiry |
PTPN6-6096H | Recombinant Human PTPN6 Protein (Lys243-Ile541), C-His tagged | +Inquiry |
Ptpn6-1102M | Recombinant Mouse Ptpn6 Protein, MYC/DDK-tagged | +Inquiry |
PTPN6-222H | Recombinant Human PTPN6 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPN6-001MCL | Recombinant Mouse PTPN6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPN6 Products
Required fields are marked with *
My Review for All PTPN6 Products
Required fields are marked with *