Recombinant Human PTPRS protein, GST-tagged
Cat.No. : | PTPRS-301632H |
Product Overview : | Recombinant Human PTPRS (25-128 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gly25-Pro128 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | GGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLRGP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PTPRS protein tyrosine phosphatase, receptor type, S [ Homo sapiens ] |
Official Symbol | PTPRS |
Synonyms | PTPRS; protein tyrosine phosphatase, receptor type, S; receptor-type tyrosine-protein phosphatase S; R-PTP-S; R-PTP-sigma; protein tyrosine phosphatase PTPsigma; receptor-type tyrosine-protein phosphatase sigma; protein tyrosine phosphatase, receptor type, sigma; PTPSIGMA; |
Gene ID | 5802 |
mRNA Refseq | NM_002850 |
Protein Refseq | NP_002841 |
MIM | 601576 |
UniProt ID | Q13332 |
◆ Recombinant Proteins | ||
PTPRS-301632H | Recombinant Human PTPRS protein, GST-tagged | +Inquiry |
PTPRS-4504R | Recombinant Rat PTPRS Protein, His (Fc)-Avi-tagged | +Inquiry |
Ptprs-4510M | Recombinant Mouse Ptprs protein, His&Myc-tagged | +Inquiry |
Ptprs-5252M | Recombinant Mouse Ptprs Protein, Myc/DDK-tagged | +Inquiry |
PTPRS-31118TH | Recombinant Human PTPRS | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPRS-2670HCL | Recombinant Human PTPRS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPRS Products
Required fields are marked with *
My Review for All PTPRS Products
Required fields are marked with *