Recombinant Human RAD50 protein, GST-tagged
Cat.No. : | RAD50-301476H |
Product Overview : | Recombinant Human RAD50 (275-425 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu275-Lys425 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LDSRKKQMEKDNSELEEKMEKVFQGTDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVRERQEGEAKTANQLMNDFAEKETLK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RAD50 RAD50 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | RAD50 |
Synonyms | RAD50; RAD50 homolog (S. cerevisiae); RAD50 (S. cerevisiae) homolog; DNA repair protein RAD50; hRad50; RAD50 2; NBSLD; RAD502; |
Gene ID | 10111 |
mRNA Refseq | NM_005732 |
Protein Refseq | NP_005723 |
MIM | 604040 |
UniProt ID | Q92878 |
◆ Recombinant Proteins | ||
Rad50-1746M | Recombinant Mouse Rad50 protein, His & T7-tagged | +Inquiry |
RAD50-4910R | Recombinant Rat RAD50 Protein | +Inquiry |
RAD50-5516H | Recombinant Human RAD50 Protein (Thr437-Val792), N-His tagged | +Inquiry |
RAD50-301476H | Recombinant Human RAD50 protein, GST-tagged | +Inquiry |
RAD50-4569R | Recombinant Rat RAD50 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAD50-2557HCL | Recombinant Human RAD50 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAD50 Products
Required fields are marked with *
My Review for All RAD50 Products
Required fields are marked with *
0
Inquiry Basket