Recombinant Human RAD50 protein, His&Myc-tagged
Cat.No. : | RAD50-5353H |
Product Overview : | Recombinant Human RAD50 protein(Q92878)(1-235aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-235aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSMVCTQKSKKTEFKTLEGVITRTKHGEKVSLSSKCAEIDREMISSLGVSKAVLNNVIFCHQEDSNWPLSEGKALKQKFDEIFSATRYIKALETLRQVRQTQGQKVKEYQMELKYLKQYKEKACEIRDQITSKEAQLT |
Gene Name | RAD50 RAD50 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | RAD50 |
Synonyms | RAD50; RAD50 homolog (S. cerevisiae); RAD50 (S. cerevisiae) homolog; DNA repair protein RAD50; hRad50; RAD50 2; NBSLD; RAD502; |
Gene ID | 10111 |
mRNA Refseq | NM_005732 |
Protein Refseq | NP_005723 |
MIM | 604040 |
UniProt ID | Q92878 |
◆ Recombinant Proteins | ||
RAD50-5353H | Recombinant Human RAD50 protein, His&Myc-tagged | +Inquiry |
RAD50-4569R | Recombinant Rat RAD50 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAD50-301476H | Recombinant Human RAD50 protein, GST-tagged | +Inquiry |
RAD50-1744H | Recombinant Human RAD50 protein, His-tagged | +Inquiry |
RAD50-5516H | Recombinant Human RAD50 Protein (Thr437-Val792), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAD50-2557HCL | Recombinant Human RAD50 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAD50 Products
Required fields are marked with *
My Review for All RAD50 Products
Required fields are marked with *