Recombinant Human RCC1 Protein, GST-Tagged
Cat.No. : | RCC1-1326H |
Product Overview : | Human CHC1 partial ORF (AAH07300, 312 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | RCC1 (Regulator Of Chromosome Condensation 1) is a Protein Coding gene. Diseases associated with RCC1 include Renal-Hepatic-Pancreatic Dysplasia and Retinitis Pigmentosa. Among its related pathways are HIV Life Cycle and Ran Pathway. GO annotations related to this gene include chromatin binding and nucleosomal DNA binding. An important paralog of this gene is RPGR. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RCC1 regulator of chromosome condensation 1 [ Homo sapiens ] |
Official Symbol | RCC1 |
Synonyms | RCC1; regulator of chromosome condensation 1; CHC1, chromosome condensation 1; regulator of chromosome condensation; cell cycle regulatory protein; SNHG3-RCC1 readthrough transcript; guanine nucleotide-releasing protein; CHC1; RCC1-I; SNHG3-RCC1; |
Gene ID | 1104 |
mRNA Refseq | NM_001048194 |
Protein Refseq | NP_001041659 |
MIM | 179710 |
UniProt ID | P18754 |
◆ Recombinant Proteins | ||
RCC1-2229H | Recombinant Human RCC1 protein, GST-tagged | +Inquiry |
Rcc1-019M | Recombinant Full Length Mouse Rcc1 Protein, MYC/DDK-tagged | +Inquiry |
RCC1-2230H | Recombinant Human RCC1 protein, His-tagged | +Inquiry |
RCC1-738HFL | Recombinant Full Length Human RCC1 Protein, C-Flag-tagged | +Inquiry |
RCC1-1868H | Recombinant Human RCC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCC1-2445HCL | Recombinant Human RCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCC1 Products
Required fields are marked with *
My Review for All RCC1 Products
Required fields are marked with *
0
Inquiry Basket