Recombinant Human RCC1 Protein, GST-Tagged

Cat.No. : RCC1-1326H
Product Overview : Human CHC1 partial ORF (AAH07300, 312 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RCC1 (Regulator Of Chromosome Condensation 1) is a Protein Coding gene. Diseases associated with RCC1 include Renal-Hepatic-Pancreatic Dysplasia and Retinitis Pigmentosa. Among its related pathways are HIV Life Cycle and Ran Pathway. GO annotations related to this gene include chromatin binding and nucleosomal DNA binding. An important paralog of this gene is RPGR.
Molecular Mass : 37.73 kDa
AA Sequence : EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RCC1 regulator of chromosome condensation 1 [ Homo sapiens ]
Official Symbol RCC1
Synonyms RCC1; regulator of chromosome condensation 1; CHC1, chromosome condensation 1; regulator of chromosome condensation; cell cycle regulatory protein; SNHG3-RCC1 readthrough transcript; guanine nucleotide-releasing protein; CHC1; RCC1-I; SNHG3-RCC1;
Gene ID 1104
mRNA Refseq NM_001048194
Protein Refseq NP_001041659
MIM 179710
UniProt ID P18754

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RCC1 Products

Required fields are marked with *

My Review for All RCC1 Products

Required fields are marked with *

0
cart-icon