Recombinant Human RCC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RCC1-1340H
Product Overview : RCC1 MS Standard C13 and N15-labeled recombinant protein (NP_001260) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RCC1 (Regulator Of Chromosome Condensation 1) is a Protein Coding gene. Diseases associated with RCC1 include Raynaud Disease and Microcystic Meningioma. Among its related pathways are Cell cycle_Spindle assembly and chromosome separation and Transport of the SLBP independent Mature mRNA. Gene Ontology (GO) annotations related to this gene include chromatin binding and nucleosomal DNA binding. An important paralog of this gene is HERC1.
Molecular Mass : 45 kDa
AA Sequence : MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RCC1 regulator of chromosome condensation 1 [ Homo sapiens (human) ]
Official Symbol RCC1
Synonyms RCC1; regulator of chromosome condensation 1; CHC1, chromosome condensation 1; regulator of chromosome condensation; cell cycle regulatory protein; SNHG3-RCC1 readthrough transcript; guanine nucleotide-releasing protein; CHC1; RCC1-I; SNHG3-RCC1;
Gene ID 1104
mRNA Refseq NM_001269
Protein Refseq NP_001260
MIM 179710
UniProt ID P18754

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RCC1 Products

Required fields are marked with *

My Review for All RCC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon