Recombinant Human RCC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RCC1-1340H |
Product Overview : | RCC1 MS Standard C13 and N15-labeled recombinant protein (NP_001260) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | RCC1 (Regulator Of Chromosome Condensation 1) is a Protein Coding gene. Diseases associated with RCC1 include Raynaud Disease and Microcystic Meningioma. Among its related pathways are Cell cycle_Spindle assembly and chromosome separation and Transport of the SLBP independent Mature mRNA. Gene Ontology (GO) annotations related to this gene include chromatin binding and nucleosomal DNA binding. An important paralog of this gene is HERC1. |
Molecular Mass : | 45 kDa |
AA Sequence : | MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RCC1 regulator of chromosome condensation 1 [ Homo sapiens (human) ] |
Official Symbol | RCC1 |
Synonyms | RCC1; regulator of chromosome condensation 1; CHC1, chromosome condensation 1; regulator of chromosome condensation; cell cycle regulatory protein; SNHG3-RCC1 readthrough transcript; guanine nucleotide-releasing protein; CHC1; RCC1-I; SNHG3-RCC1; |
Gene ID | 1104 |
mRNA Refseq | NM_001269 |
Protein Refseq | NP_001260 |
MIM | 179710 |
UniProt ID | P18754 |
◆ Recombinant Proteins | ||
RCC1-738HFL | Recombinant Full Length Human RCC1 Protein, C-Flag-tagged | +Inquiry |
RCC1-2204H | Recombinant Human RCC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RCC1-181H | Recombinant Human RCC1 Protein, Strep-tagged | +Inquiry |
RCC1-1139H | Recombinant Human Regulator Of Chromosome Condensation 1 | +Inquiry |
RCC1-01H | Recombinant Full Length Human RCC1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCC1-2445HCL | Recombinant Human RCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCC1 Products
Required fields are marked with *
My Review for All RCC1 Products
Required fields are marked with *