Recombinant Human RELA, C-Terminal Truncated

• Cat.No.: RELA-627TH
• Product Overview: The recombinant human NF-kB p65 protein contains amino acids 1-537, corresponding to GenBank no AA36408.1. This represents a C-terminal truncation of 14 amino acids; the full-length human p65 NF-kB protein is 551 amino acids.

Specification

• Species: Human
• Tag: Non
• Protein Length: 1-537 a.a.
• Description: NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.
• Purity: The protein was purified by affinity chromatography. The purity is greater than 98.0%.
• Formulation: Supplied asliquid. 5 ug protein in 10 ul (0.5 ug/ul) in Tris-HCL, 0.2 M NaCl, 2 mM MgCl2, 0.2 mM EDTA, 1M DTT.
• Stability: For long-term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.
• Biological Activity: The biological activity of this protein or its ability to bind to DNA has not been established.
• Amino Acid Sequence: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLPHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEAL LQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPML MEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSI
• Publications:
  Quantitation of the Dynamic Profiles of the Innate Immune Response Using Multiplex Selected Reaction Monitoring–Mass Spectrometry (2013)

Gene Information

• Gene Name: RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ]
• Official Symbol: RELA
• Synonyms: RELA; v-rel reticuloendotheliosis viral oncogene homolog A (avian); p65; NFKB3; transcription factor p65; NF-kappa-B p65delta3; nuclear factor NF-kappa-B p65 subunit; nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 ;OTTHUMP00000233474; OTTHUMP00000233475; OTTHUMP00000233475; OTTHUMP00000233900; OTTHUMP00000233473; MGC131774; light polypeptide gene enhancer in B-cells 3, p65
• Gene ID: 5970
• mRNA Refseq: NM_001145138
• Protein Refseq: NP_001138610
• MIM: 164014
• UniProt ID: Q04206
• Chromosome Location: 11q13
• Pathway: Activated TLR4 signalling;Acute myeloid leukemia;Angiopoietin receptor Tie2-mediated signaling; B Cell Receptor Signaling Pathway; Cytokine Signaling in Immune system