Recombinant Human ROR1 protein(11-400 aa), C-His-tagged
Cat.No. : | ROR1-2818H |
Product Overview : | Recombinant Human ROR1 protein(Q01973)(11-400 aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 11-400 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 43.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | PPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKN |
Gene Name | ROR1 receptor tyrosine kinase-like orphan receptor 1 [ Homo sapiens ] |
Official Symbol | ROR1 |
Synonyms | ROR1; receptor tyrosine kinase-like orphan receptor 1; NTRKR1; tyrosine-protein kinase transmembrane receptor ROR1; neurotrophic tyrosine kinase receptor-related 1; neurotrophic tyrosine kinase, receptor-related 1; dJ537F10.1; MGC99659; |
Gene ID | 4919 |
mRNA Refseq | NM_001083592 |
Protein Refseq | NP_001077061 |
MIM | 602336 |
UniProt ID | Q01973 |
◆ Recombinant Proteins | ||
ROR1-1934H | Recombinant Human ROR1 protein, His-tagged | +Inquiry |
ROR1-14377M | Recombinant Mouse ROR1 Protein | +Inquiry |
ROR1-2818H | Recombinant Human ROR1 protein(11-400 aa), C-His-tagged | +Inquiry |
ROR1-387HP | Recombinant Human ROR1 protein, Fc-tagged, R-PE labeled | +Inquiry |
ROR1-973H | Recombinant Human ROR1 protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ROR1-002HCL | Recombinant Human ROR1 cell lysate | +Inquiry |
ROR1-001HCL | Recombinant Human ROR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROR1 Products
Required fields are marked with *
My Review for All ROR1 Products
Required fields are marked with *