Recombinant Human ROR1 protein(11-400 aa), C-His-tagged
| Cat.No. : | ROR1-2818H |
| Product Overview : | Recombinant Human ROR1 protein(Q01973)(11-400 aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 11-400 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 43.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | PPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKN |
| Gene Name | ROR1 receptor tyrosine kinase-like orphan receptor 1 [ Homo sapiens ] |
| Official Symbol | ROR1 |
| Synonyms | ROR1; receptor tyrosine kinase-like orphan receptor 1; NTRKR1; tyrosine-protein kinase transmembrane receptor ROR1; neurotrophic tyrosine kinase receptor-related 1; neurotrophic tyrosine kinase, receptor-related 1; dJ537F10.1; MGC99659; |
| Gene ID | 4919 |
| mRNA Refseq | NM_001083592 |
| Protein Refseq | NP_001077061 |
| MIM | 602336 |
| UniProt ID | Q01973 |
| ◆ Cell & Tissue Lysates | ||
| ROR1-001HCL | Recombinant Human ROR1 cell lysate | +Inquiry |
| ROR1-002HCL | Recombinant Human ROR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROR1 Products
Required fields are marked with *
My Review for All ROR1 Products
Required fields are marked with *



