Recombinant Human ROR1 protein(11-400 aa), C-His-tagged

• Cat.No.: ROR1-2818H
• Product Overview: Recombinant Human ROR1 protein(Q01973)(11-400 aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 11-400 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 43.5 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: PPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKN

Gene Information

• Gene Name: ROR1 receptor tyrosine kinase-like orphan receptor 1 [ Homo sapiens ]
• Official Symbol: ROR1
• Synonyms: ROR1; receptor tyrosine kinase-like orphan receptor 1; NTRKR1; tyrosine-protein kinase transmembrane receptor ROR1; neurotrophic tyrosine kinase receptor-related 1; neurotrophic tyrosine kinase, receptor-related 1; dJ537F10.1; MGC99659
• Gene ID: 4919
• mRNA Refseq: NM_001083592
• Protein Refseq: NP_001077061
• MIM: 602336
• UniProt ID: Q01973