Recombinant Human RUNX3 protein, His-tagged

Cat.No. : RUNX3-7855H
Product Overview : Recombinant Human RUNX3 protein(207-251 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 207-251 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : PFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTS
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name RUNX3 runt-related transcription factor 3 [ Homo sapiens ]
Official Symbol RUNX3
Synonyms RUNX3; runt-related transcription factor 3; CBFA3; AML2; PEBP2A3; CBF-alpha-3; PEA2 alpha C; PEA2-alpha C; PEBP2 alpha C; PEBP2-alpha C; oncogene AML-2; transcription factor AML2; acute myeloid leukemia gene 2; acute myeloid leukemia 2 protein; core-binding factor subunit alpha-3; SL3-3 enhancer factor 1 alpha C subunit; SL3/AKV core-binding factor alpha C subunit; core-binding factor, runt domain, alpha subunit 3; polyomavirus enhancer-binding protein 2 alpha C subunit; PEBP2aC; FLJ34510; MGC16070;
mRNA Refseq NM_001031680
Protein Refseq NP_001026850
MIM 600210
UniProt ID Q13761
Gene ID 864

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RUNX3 Products

Required fields are marked with *

My Review for All RUNX3 Products

Required fields are marked with *

0
cart-icon
0
compare icon