Recombinant Human RYR1 protein, GST-tagged
| Cat.No. : | RYR1-6742H |
| Product Overview : | Recombinant Human RYR1 protein(1282-1430 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1282-1430 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEGTAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | RYR1 |
| Synonyms | RYR1 |
| Gene ID | 6261 |
| mRNA Refseq | NM_000540 |
| Protein Refseq | NP_000531 |
| MIM | 180901 |
| UniProt ID | P21817 |
| ◆ Recombinant Proteins | ||
| RYR1-301225H | Recombinant Human RYR1 protein, GST-tagged | +Inquiry |
| RYR1-6742H | Recombinant Human RYR1 protein, GST-tagged | +Inquiry |
| Ryr1-2669M | Recombinant Mouse Ryr1 Protein, His&GST-tagged | +Inquiry |
| RYR1-357H | Recombinant Human RYR1 | +Inquiry |
| RYR1-789H | Recombinant Human RYR1 Protein (1-534 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RYR1 Products
Required fields are marked with *
My Review for All RYR1 Products
Required fields are marked with *
