Recombinant Human RYR1 protein, GST-tagged
Cat.No. : | RYR1-301225H |
Product Overview : | Recombinant Human RYR1 (4942-5038 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gly4942-Ser5038 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | GELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RYR1 ryanodine receptor 1 [ Homo sapiens (human) ] |
Official Symbol | RYR1 |
Synonyms | CCO; MHS; RYR; MHS1; RYDR; SKRR; RYR-1; PPP1R137 |
Gene ID | 6261 |
mRNA Refseq | NM_000540 |
Protein Refseq | NP_000531 |
MIM | 180901 |
UniProt ID | P21817 |
◆ Recombinant Proteins | ||
RYR1-789H | Recombinant Human RYR1 Protein (1-534 aa), His-tagged | +Inquiry |
Ryr1-2038R | Recombinant Rat Ryr1 Protein, His-tagged | +Inquiry |
Ryr1-2669M | Recombinant Mouse Ryr1 Protein, His&GST-tagged | +Inquiry |
RYR1-790H | Recombinant Human RYR1 protein (Skeletal), His-tagged | +Inquiry |
RYR1-301225H | Recombinant Human RYR1 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RYR1 Products
Required fields are marked with *
My Review for All RYR1 Products
Required fields are marked with *