Recombinant Human S100A5 protein, GST-tagged

Cat.No. : S100A5-30157H
Product Overview : Recombinant Human S100A5 (1-110 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Lys110
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name S100A5 S100 calcium binding protein A5 [ Homo sapiens ]
Official Symbol S100A5
Synonyms S100A5; S100 calcium binding protein A5; S100 calcium binding protein A5 , S100D; protein S100-A5; S100 calcium-binding protein A5; S100D;
Gene ID 6276
mRNA Refseq NM_002962
Protein Refseq NP_002953
MIM 176991
UniProt ID P33763

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100A5 Products

Required fields are marked with *

My Review for All S100A5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon