Recombinant Human S100A5 protein, GST-tagged
| Cat.No. : | S100A5-30157H |
| Product Overview : | Recombinant Human S100A5 (1-110 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Lys110 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | S100A5 S100 calcium binding protein A5 [ Homo sapiens ] |
| Official Symbol | S100A5 |
| Synonyms | S100A5; S100 calcium binding protein A5; S100 calcium binding protein A5 , S100D; protein S100-A5; S100 calcium-binding protein A5; S100D; |
| Gene ID | 6276 |
| mRNA Refseq | NM_002962 |
| Protein Refseq | NP_002953 |
| MIM | 176991 |
| UniProt ID | P33763 |
| ◆ Recombinant Proteins | ||
| S100A5-5408H | Recombinant Human S100A5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| S100A5-2490H | Recombinant Human S100A5, His-tagged | +Inquiry |
| S100a5-15850M | Recombinant Mouse S100a5, His-tagged | +Inquiry |
| S100a5-7014M | Recombinant Mouse S100a5 protein(Met1-Lys93), His-tagged | +Inquiry |
| S100A5-3415H | Recombinant Human S100A5, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100A5-2089HCL | Recombinant Human S100A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A5 Products
Required fields are marked with *
My Review for All S100A5 Products
Required fields are marked with *


