Recombinant Human S100A9 protein, GST-tagged
Cat.No. : | S100A9-301159H |
Product Overview : | Recombinant Human S100A9 (25-114 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Lys25-Pro114 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | S100A9 S100 calcium binding protein A9 [ Homo sapiens ] |
Official Symbol | S100A9 |
Synonyms | S100A9; S100 calcium binding protein A9; CAGB, CFAG, S100 calcium binding protein A9 (calgranulin B) , S100 calcium binding protein A9 (calgranulin B); protein S100-A9; 60B8AG; CGLB; LIAG; MAC387; MIF; MRP14; NIF; P14; MRP-14; calgranulin B; calgranulin-B; calprotectin L1H subunit; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14; S100 calcium-binding protein A9 (calgranulin B); CAGB; CFAG; L1AG; |
Gene ID | 6280 |
mRNA Refseq | NM_002965 |
Protein Refseq | NP_002956 |
MIM | 123886 |
UniProt ID | P06702 |
◆ Recombinant Proteins | ||
S100A9-301159H | Recombinant Human S100A9 protein, GST-tagged | +Inquiry |
S100a9-7393M | Recombinant Mouse S100a9 protein, His-tagged | +Inquiry |
S100a9-1362H | Recombinant Rat S100a9 Protein, His-SUMO-tagged | +Inquiry |
S100A9-202H | Recombinant Human S100A9 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
S100a9-5672M | Recombinant Mouse S100a9 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A9-684HCL | Recombinant Human S100A9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A9 Products
Required fields are marked with *
My Review for All S100A9 Products
Required fields are marked with *