Recombinant Human SAA1 protein, His-tagged
Cat.No. : | SAA1-3463H |
Product Overview : | Recombinant Human SAA1 protein(23-122 aa), fused to His tag, was expressed in E. coli. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-122 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SAA1 serum amyloid A1 [ Homo sapiens ] |
Official Symbol | SAA1 |
Synonyms | SAA1; serum amyloid A1; SAA; serum amyloid A protein; PIG4; TP53I4; tumor protein p53 inducible protein 4; SAA2; MGC111216; |
Gene ID | 6288 |
mRNA Refseq | NM_000331 |
Protein Refseq | NP_000322 |
MIM | 104750 |
UniProt ID | P02735 |
◆ Recombinant Proteins | ||
SAA1-2375R | Recombinant Rabbit SAA1 Protein (20-122 aa), His-SUMO-Myc-tagged | +Inquiry |
SAA1-31162TH | Recombinant Human SAA1 | +Inquiry |
SAA1-2345H | Recombinant Horse SAA1 Protein (1-110 aa), His-tagged | +Inquiry |
SAA1-6233H | Recombinant Human SAA1 Protein, His-tagged | +Inquiry |
SAA1-15F | Recombinant Feline SAA1 Protein (1-111) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *
0
Inquiry Basket