Recombinant Human SAA1 protein, His-tagged
| Cat.No. : | SAA1-3463H |
| Product Overview : | Recombinant Human SAA1 protein(23-122 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-122 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SAA1 serum amyloid A1 [ Homo sapiens ] |
| Official Symbol | SAA1 |
| Synonyms | SAA1; serum amyloid A1; SAA; serum amyloid A protein; PIG4; TP53I4; tumor protein p53 inducible protein 4; SAA2; MGC111216; |
| Gene ID | 6288 |
| mRNA Refseq | NM_000331 |
| Protein Refseq | NP_000322 |
| MIM | 104750 |
| UniProt ID | P02735 |
| ◆ Recombinant Proteins | ||
| SAA1-1052H | Recombinant Human SAA Protein | +Inquiry |
| SAA1-14633M | Recombinant Mouse SAA1 Protein | +Inquiry |
| SAA1-31166TH | Recombinant Human SAA1, His-tagged | +Inquiry |
| SAA1-31162TH | Recombinant Human SAA1 | +Inquiry |
| SAA1-71M | Recombinant Full Length Mouse SAA1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
| SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *
