Species : |
Rhesus macaque |
Source : |
E.coli |
Protein Length : |
104 |
Description : |
Serum amyloid A proteins (SAA) represents a family of apolipoproteins that circulates in association with high-density lipoproteins (HDL). The level of apo-SAA, normally 1-5 μg/mL in plasma, increases 500-1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL apo-lipoprotein. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
Fully biologically active when compared to standard. Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/mL, corresponding to a Specific Activity of >1 × 10^5 IU/mg. |
Molecular Mass : |
Approximately 11.8 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids. |
AA Sequence : |
RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGGVWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGLPEKY |
Endotoxin : |
Less than 1 EU/μg of rRhSAA1 as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : |
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |