Recombinant Human SENP8 protein, His-tagged

Cat.No. : SENP8-3916H
Product Overview : Recombinant Human SENP8 protein(1-212 aa), fused to His tag, was expressed in E. coli.
Availability July 03, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-212 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SENP8 SUMO/sentrin specific peptidase family member 8 [ Homo sapiens ]
Official Symbol SENP8
Synonyms SENP8; SUMO/sentrin specific peptidase family member 8; protease, cysteine, 2 (NEDD8 specific) , PRSC2, SUMO/sentrin specific protease family member 8; sentrin-specific protease 8; DEN1; deneddylase 1; HsT17512; NEDD8 specific protease 1; NEDP1; sentrin/SUMO specific protease SENP8; deneddylase-1; protease, cysteine 2; NEDD8-specific protease 1; NEDD8 specific-protease cysteine 2; SUMO sentrin specific protease family member 8; PRSC2;
Gene ID 123228
mRNA Refseq NM_001166340
Protein Refseq NP_001159812
MIM 608659
UniProt ID Q96LD8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SENP8 Products

Required fields are marked with *

My Review for All SENP8 Products

Required fields are marked with *

0
cart-icon
0
compare icon