Recombinant Human SENP8 protein, His-tagged
Cat.No. : | SENP8-3916H |
Product Overview : | Recombinant Human SENP8 protein(1-212 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-212 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SENP8 SUMO/sentrin specific peptidase family member 8 [ Homo sapiens ] |
Official Symbol | SENP8 |
Synonyms | SENP8; SUMO/sentrin specific peptidase family member 8; protease, cysteine, 2 (NEDD8 specific) , PRSC2, SUMO/sentrin specific protease family member 8; sentrin-specific protease 8; DEN1; deneddylase 1; HsT17512; NEDD8 specific protease 1; NEDP1; sentrin/SUMO specific protease SENP8; deneddylase-1; protease, cysteine 2; NEDD8-specific protease 1; NEDD8 specific-protease cysteine 2; SUMO sentrin specific protease family member 8; PRSC2; |
Gene ID | 123228 |
mRNA Refseq | NM_001166340 |
Protein Refseq | NP_001159812 |
MIM | 608659 |
UniProt ID | Q96LD8 |
◆ Recombinant Proteins | ||
SENP8-70H | Recombinant Human SENP8, His-tagged | +Inquiry |
SENP8-5549C | Recombinant Chicken SENP8 | +Inquiry |
SENP8-0887H | Recombinant Human SENP8 Protein (D2-K212), Tag Free | +Inquiry |
SENP8-6271H | Recombinant Human SENP8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SENP8-4644H | Recombinant Human SENP8 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SENP8-1970HCL | Recombinant Human SENP8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SENP8 Products
Required fields are marked with *
My Review for All SENP8 Products
Required fields are marked with *
0
Inquiry Basket