Recombinant Human SIGIRR protein, His-tagged
Cat.No. : | SIGIRR-4659H |
Product Overview : | Recombinant Human SIGIRR protein(Q6IA17)(1-118 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-118 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 14.6 kDa |
AASequence : | MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | SIGIRR single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Homo sapiens ] |
Official Symbol | SIGIRR |
Synonyms | SIGIRR; single immunoglobulin and toll-interleukin 1 receptor (TIR) domain; single Ig IL-1-related receptor; single immunoglobulin domain IL1R1 related; TIR8; toll/interleukin-1 receptor 8; single Ig IL-1R-related molecule; single immunoglobulin domain-containing IL1R-related protein; MGC110992; |
Gene ID | 59307 |
mRNA Refseq | NM_001135053 |
Protein Refseq | NP_001128525 |
MIM | 605478 |
UniProt ID | Q6IA17 |
◆ Recombinant Proteins | ||
SIGIRR-6152H | Recombinant Human SIGIRR Protein (Met1-His118), His tagged | +Inquiry |
SIGIRR-5059R | Recombinant Rat SIGIRR Protein, His (Fc)-Avi-tagged | +Inquiry |
SIGIRR-422H | Recombinant Human SIGIRR, Fc tagged | +Inquiry |
SIGIRR-1685H | Recombinant Human SIGIRR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SIGIRR-1950H | Recombinant Human SIGIRR protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIGIRR-1091HCL | Recombinant Human SIGIRR cell lysate | +Inquiry |
SIGIRR-2773MCL | Recombinant Mouse SIGIRR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIGIRR Products
Required fields are marked with *
My Review for All SIGIRR Products
Required fields are marked with *