Recombinant Human SIGIRR protein, His-tagged

Cat.No. : SIGIRR-4659H
Product Overview : Recombinant Human SIGIRR protein(Q6IA17)(1-118 aa), fused with N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-118 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 14.6 kDa
AASequence : MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name SIGIRR single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Homo sapiens ]
Official Symbol SIGIRR
Synonyms SIGIRR; single immunoglobulin and toll-interleukin 1 receptor (TIR) domain; single Ig IL-1-related receptor; single immunoglobulin domain IL1R1 related; TIR8; toll/interleukin-1 receptor 8; single Ig IL-1R-related molecule; single immunoglobulin domain-containing IL1R-related protein; MGC110992;
Gene ID 59307
mRNA Refseq NM_001135053
Protein Refseq NP_001128525
MIM 605478
UniProt ID Q6IA17

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIGIRR Products

Required fields are marked with *

My Review for All SIGIRR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon