Recombinant Human SIGIRR protein, His-tagged
| Cat.No. : | SIGIRR-4659H |
| Product Overview : | Recombinant Human SIGIRR protein(Q6IA17)(1-118 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-118 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 14.6 kDa |
| AASequence : | MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | SIGIRR single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Homo sapiens ] |
| Official Symbol | SIGIRR |
| Synonyms | SIGIRR; single immunoglobulin and toll-interleukin 1 receptor (TIR) domain; single Ig IL-1-related receptor; single immunoglobulin domain IL1R1 related; TIR8; toll/interleukin-1 receptor 8; single Ig IL-1R-related molecule; single immunoglobulin domain-containing IL1R-related protein; MGC110992; |
| Gene ID | 59307 |
| mRNA Refseq | NM_001135053 |
| Protein Refseq | NP_001128525 |
| MIM | 605478 |
| UniProt ID | Q6IA17 |
| ◆ Recombinant Proteins | ||
| SIGIRR-5059R | Recombinant Rat SIGIRR Protein, His (Fc)-Avi-tagged | +Inquiry |
| SIGIRR-674H | Recombinant Human SIGIRR, Fc-tagged, Biotinylated | +Inquiry |
| SIGIRR-28784TH | Recombinant Human SIGIRR protein, Fc-tagged | +Inquiry |
| Sigirr-1952R | Recombinant Rat Sigirr protein, His-tagged | +Inquiry |
| Sigirr-501M | Recombinant Mouse Sigirr | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIGIRR-1091HCL | Recombinant Human SIGIRR cell lysate | +Inquiry |
| SIGIRR-2773MCL | Recombinant Mouse SIGIRR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIGIRR Products
Required fields are marked with *
My Review for All SIGIRR Products
Required fields are marked with *
