Recombinant Human SNCA protein(11-110 aa), C-His-tagged
Cat.No. : | SNCA-2744H |
Product Overview : | Recombinant Human SNCA protein(P37840)(11-110 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-110 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 11 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | AKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQE |
Gene Name | SNCA synuclein, alpha (non A4 component of amyloid precursor) [ Homo sapiens ] |
Official Symbol | SNCA |
Synonyms | SNCA; synuclein, alpha (non A4 component of amyloid precursor); PARK1, PARK4, Parkinson disease (autosomal dominant, Lewy body) 4; alpha-synuclein; alpha synuclein; NACP; PD1; synuclein alpha-140; non A-beta component of AD amyloid; PARK1; PARK4; MGC110988; |
Gene ID | 6622 |
mRNA Refseq | NM_000345 |
Protein Refseq | NP_000336 |
MIM | 163890 |
UniProt ID | P37840 |
◆ Recombinant Proteins | ||
SNCA-034H | Recombinant Human synuclein, alpha Protein, Tag Free, Biotin Labeled | +Inquiry |
SNCA-6239C | Recombinant Chicken SNCA | +Inquiry |
SNCA-5124H | Recombinant Human Synuclein, Alpha (Non A4 Component Of Amyloid Precursor) | +Inquiry |
SNCA-326HFL | Recombinant Full Length Human SNCA Protein, C-Flag-tagged | +Inquiry |
Snca-2730M | Recombinant Mouse Synuclein, Alpha | +Inquiry |
◆ Native Proteins | ||
SNCA-27341TH | Native Human SNCA | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
SNCA-27345TH | Native Human SNCA | +Inquiry |
SNCA-27342TH | Native Human SNCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCA-1634HCL | Recombinant Human SNCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNCA Products
Required fields are marked with *
My Review for All SNCA Products
Required fields are marked with *
0
Inquiry Basket