Recombinant Human SNCA protein(11-110 aa), C-His-tagged

• Cat.No.: SNCA-2744H
• Product Overview: Recombinant Human SNCA protein(P37840)(11-110 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 11-110 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 11 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: AKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQE

Gene Information

• Gene Name: SNCA synuclein, alpha (non A4 component of amyloid precursor) [ Homo sapiens ]
• Official Symbol: SNCA
• Synonyms: SNCA; synuclein, alpha (non A4 component of amyloid precursor); PARK1, PARK4, Parkinson disease (autosomal dominant, Lewy body) 4; alpha-synuclein; alpha synuclein; NACP; PD1; synuclein alpha-140; non A-beta component of AD amyloid; PARK1; PARK4; MGC110988
• Gene ID: 6622
• mRNA Refseq: NM_000345
• Protein Refseq: NP_000336
• MIM: 163890
• UniProt ID: P37840