Recombinant Human SNCA protein(11-110 aa), C-His-tagged
| Cat.No. : | SNCA-2744H |
| Product Overview : | Recombinant Human SNCA protein(P37840)(11-110 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 11-110 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 11 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | AKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQE |
| Gene Name | SNCA synuclein, alpha (non A4 component of amyloid precursor) [ Homo sapiens ] |
| Official Symbol | SNCA |
| Synonyms | SNCA; synuclein, alpha (non A4 component of amyloid precursor); PARK1, PARK4, Parkinson disease (autosomal dominant, Lewy body) 4; alpha-synuclein; alpha synuclein; NACP; PD1; synuclein alpha-140; non A-beta component of AD amyloid; PARK1; PARK4; MGC110988; |
| Gene ID | 6622 |
| mRNA Refseq | NM_000345 |
| Protein Refseq | NP_000336 |
| MIM | 163890 |
| UniProt ID | P37840 |
| ◆ Recombinant Proteins | ||
| SNCA-326HFL | Recombinant Full Length Human SNCA Protein, C-Flag-tagged | +Inquiry |
| SNCA-2744H | Recombinant Human SNCA protein(11-110 aa), C-His-tagged | +Inquiry |
| SNCA-2837H | Recombinant Human SNCA, GST-tagged | +Inquiry |
| Snca-386M | Recombinant Mouse Snca Protein | +Inquiry |
| SNCA-295H | Recombinant Human Synuclein, Alpha (Non A4 Component of Amyloid Precursor), 1-95 | +Inquiry |
| ◆ Native Proteins | ||
| SNCA-27342TH | Native Human SNCA | +Inquiry |
| SNCA-27339TH | Native Human SNCA | +Inquiry |
| SNCA-27341TH | Native Human SNCA | +Inquiry |
| SNCA-27345TH | Native Human SNCA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNCA-1634HCL | Recombinant Human SNCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCA Products
Required fields are marked with *
My Review for All SNCA Products
Required fields are marked with *



