Recombinant Human SPN protein, His-SUMO-tagged
Cat.No. : | SPN-3521H |
Product Overview : | Recombinant Human SPN protein(P16150)(20-253aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 20-253aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.5 kDa |
AA Sequence : | STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SPN sialophorin [ Homo sapiens ] |
Official Symbol | SPN |
Synonyms | SPN; sialophorin; sialophorin (gpL115, leukosialin, CD43); leukosialin; CD43; GPL115; LSN; GALGP; galactoglycoprotein; leukocyte sialoglycoprotein; sialophorin (leukosialin, CD43); |
Gene ID | 6693 |
mRNA Refseq | NM_001030288 |
Protein Refseq | NP_001025459 |
MIM | 182160 |
UniProt ID | P16150 |
◆ Recombinant Proteins | ||
SPN-6532H | Recombinant Human SPN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Spn-50R | Recombinant Rat Spn protein(Met1-Gly243), hFc-tagged | +Inquiry |
SPN-4264H | Recombinant Human Sialophorin | +Inquiry |
SPN-3733H | Recombinant Human SPN protein, rFc-tagged | +Inquiry |
SPN-2087H | Recombinant Human SPN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPN-893RCL | Recombinant Rat SPN cell lysate | +Inquiry |
SPN-1739MCL | Recombinant Mouse SPN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPN Products
Required fields are marked with *
My Review for All SPN Products
Required fields are marked with *