Recombinant Human SPRR2B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPRR2B-3818H
• Product Overview: SPRR2B MS Standard C13 and N15-labeled recombinant protein (NP_001017418) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
• Molecular Mass: 8 kDa
• AA Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPRR2B small proline rich protein 2B [ Homo sapiens (human) ]
• Official Symbol: SPRR2B
• Synonyms: SPRR2B; small proline rich protein 2B; small proline-rich protein 2B; SPR-2B
• Gene ID: 6701
• mRNA Refseq: NM_001017418
• Protein Refseq: NP_001017418
• MIM: 182268
• UniProt ID: P35325