Recombinant Human TAF13 Protein, GST-tagged

• Cat.No.: TAF13-821H
• Product Overview: Recombinant Human TAF13 Protien(NP_005636)(1-124 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-124 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.

Gene Information

• Gene Name: TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa [ Homo sapiens ]
• Official Symbol: TAF13
• Synonyms: TAF13; TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa; TAF2K, TATA box binding protein (TBP) associated factor, RNA polymerase II, K, 18kD; transcription initiation factor TFIID subunit 13; TAFII18; transcription initiation factor TFIID 18 kD subunit; transcription initiation factor TFIID 18 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, K, 18kD; TAF2K; TAFII-18; TAF(II)18; MGC22425
• Gene ID: 6884
• mRNA Refseq: NM_005645
• Protein Refseq: NP_005636
• MIM: 600774
• UniProt ID: Q15543