Recombinant Human TAF13 Protein, GST-tagged

Cat.No. : TAF13-821H
Product Overview : Recombinant Human TAF13 Protien(NP_005636)(1-124 aa), fused to GST tag, was expressed in E. coli.
Availability August 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-124 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa [ Homo sapiens ]
Official Symbol TAF13
Synonyms TAF13; TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa; TAF2K, TATA box binding protein (TBP) associated factor, RNA polymerase II, K, 18kD; transcription initiation factor TFIID subunit 13; TAFII18; transcription initiation factor TFIID 18 kD subunit; transcription initiation factor TFIID 18 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, K, 18kD; TAF2K; TAFII-18; TAF(II)18; MGC22425;
Gene ID 6884
mRNA Refseq NM_005645
Protein Refseq NP_005636
MIM 600774
UniProt ID Q15543

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAF13 Products

Required fields are marked with *

My Review for All TAF13 Products

Required fields are marked with *

0
cart-icon