Recombinant Human TAF13 Protein, GST-tagged
Cat.No. : | TAF13-821H |
Product Overview : | Recombinant Human TAF13 Protien(NP_005636)(1-124 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-124 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa [ Homo sapiens ] |
Official Symbol | TAF13 |
Synonyms | TAF13; TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa; TAF2K, TATA box binding protein (TBP) associated factor, RNA polymerase II, K, 18kD; transcription initiation factor TFIID subunit 13; TAFII18; transcription initiation factor TFIID 18 kD subunit; transcription initiation factor TFIID 18 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, K, 18kD; TAF2K; TAFII-18; TAF(II)18; MGC22425; |
Gene ID | 6884 |
mRNA Refseq | NM_005645 |
Protein Refseq | NP_005636 |
MIM | 600774 |
UniProt ID | Q15543 |
◆ Recombinant Proteins | ||
TAF13-1399C | Recombinant Chicken TAF13 | +Inquiry |
Taf13-6277M | Recombinant Mouse Taf13 Protein, Myc/DDK-tagged | +Inquiry |
TAF13-1375Z | Recombinant Zebrafish TAF13 | +Inquiry |
TAF13-826H | Recombinant Human TAF13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TAF13-821H | Recombinant Human TAF13 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAF13-1275HCL | Recombinant Human TAF13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAF13 Products
Required fields are marked with *
My Review for All TAF13 Products
Required fields are marked with *