Recombinant Human TAF13 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TAF13-826H |
| Product Overview : | TAF13 MS Standard C13 and N15-labeled recombinant protein (NP_005636) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6. |
| Molecular Mass : | 14.3 kDa |
| AA Sequence : | MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TAF13 TATA-box binding protein associated factor 13 [ Homo sapiens (human) ] |
| Official Symbol | TAF13 |
| Synonyms | TAF13; TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa; TAF2K, TATA box binding protein (TBP) associated factor, RNA polymerase II, K, 18kD; transcription initiation factor TFIID subunit 13; TAFII18; transcription initiation factor TFIID 18 kD subunit; transcription initiation factor TFIID 18 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, K, 18kD; TAF2K; TAFII-18; TAF(II)18; MGC22425; |
| Gene ID | 6884 |
| mRNA Refseq | NM_005645 |
| Protein Refseq | NP_005636 |
| MIM | 600774 |
| UniProt ID | Q15543 |
| ◆ Recombinant Proteins | ||
| Taf13-6277M | Recombinant Mouse Taf13 Protein, Myc/DDK-tagged | +Inquiry |
| TAF13-821H | Recombinant Human TAF13 Protein, GST-tagged | +Inquiry |
| TAF13-826H | Recombinant Human TAF13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TAF13-1399C | Recombinant Chicken TAF13 | +Inquiry |
| TAF13-1226H | Recombinant Human TAF13 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TAF13-1275HCL | Recombinant Human TAF13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAF13 Products
Required fields are marked with *
My Review for All TAF13 Products
Required fields are marked with *
