Recombinant Human TAF13 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TAF13-826H
Product Overview : TAF13 MS Standard C13 and N15-labeled recombinant protein (NP_005636) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6.
Molecular Mass : 14.3 kDa
AA Sequence : MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TAF13 TATA-box binding protein associated factor 13 [ Homo sapiens (human) ]
Official Symbol TAF13
Synonyms TAF13; TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa; TAF2K, TATA box binding protein (TBP) associated factor, RNA polymerase II, K, 18kD; transcription initiation factor TFIID subunit 13; TAFII18; transcription initiation factor TFIID 18 kD subunit; transcription initiation factor TFIID 18 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, K, 18kD; TAF2K; TAFII-18; TAF(II)18; MGC22425;
Gene ID 6884
mRNA Refseq NM_005645
Protein Refseq NP_005636
MIM 600774
UniProt ID Q15543

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAF13 Products

Required fields are marked with *

My Review for All TAF13 Products

Required fields are marked with *

0
cart-icon
0
compare icon