Recombinant Human THPO protein(22-353 aa), N-SUMO & N-His-tagged
Cat.No. : | THPO-2755H |
Product Overview : | Recombinant Human THPO protein(P40225)(22-353 aa), fused with N-terminal SUMO tag and N-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&SUMO |
Protein Length : | 22-353 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG |
Gene Name | THPO thrombopoietin [ Homo sapiens (human) ] |
Official Symbol | THPO |
Synonyms | THPO; thrombopoietin; ML; TPO; MGDF; MKCSF; MPLLG; THCYT1; thrombopoietin; MPL ligand; c-mpl ligand; megakaryocyte colony-stimulating factor; megakaryocyte growth and development factor; megakaryocyte stimulating factor; myeloproliferative leukemia virus oncogene ligand; prepro-thrombopoietin; thrombopoietin nirs |
Gene ID | 7066 |
mRNA Refseq | NM_000460 |
Protein Refseq | NP_000451 |
MIM | 600044 |
UniProt ID | P40225 |
◆ Recombinant Proteins | ||
THPO-98H | Recombinant Human Thrombopoietin, His-tagged | +Inquiry |
THPO-99H | Recombinant Human THPO protein, His-tagged | +Inquiry |
THPO-305H | Recombinant Active Human THPO Protein, His-tagged(N-ter) | +Inquiry |
THPO-2753H | Recombinant Human THPO protein(22-353 aa), N-SUMO & C-His-tagged | +Inquiry |
Thpo-1531M | Recombinant Mouse Thpo protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
THPO-2273CCL | Recombinant Cynomolgus THPO cell lysate | +Inquiry |
THPO-001HCL | Recombinant Human THPO cell lysate | +Inquiry |
THPO-2831MCL | Recombinant Mouse THPO cell lysate | +Inquiry |
THPO-2832HCL | Recombinant Human THPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All THPO Products
Required fields are marked with *
My Review for All THPO Products
Required fields are marked with *
0
Inquiry Basket