Recombinant Human TNFRSF11B protein(91-160 aa), N-MBP & C-His-tagged
| Cat.No. : | TNFRSF11B-2454H |
| Product Overview : | Recombinant Human TNFRSF11B protein(O00300)(91-160 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&MBP |
| Protein Length : | 91-160 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | QYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPC |
| Gene Name | TNFRSF11B tumor necrosis factor receptor superfamily, member 11b [ Homo sapiens ] |
| Official Symbol | TNFRSF11B |
| Synonyms | TNFRSF11B; tumor necrosis factor receptor superfamily, member 11b; OPG, osteoprotegerin; tumor necrosis factor receptor superfamily member 11B; OCIF; TR1; osteoprotegerin; osteoclastogenesis inhibitory factor; OPG; MGC29565; |
| Gene ID | 4982 |
| mRNA Refseq | NM_002546 |
| Protein Refseq | NP_002537 |
| MIM | 602643 |
| UniProt ID | O00300 |
| ◆ Recombinant Proteins | ||
| TNFRSF11B-28920TH | Recombinant Human TNFRSF11B, His-tagged | +Inquiry |
| TNFRSF11B-4141H | Active Recombinant Human Tumor Necrosis Factor Receptor Superfamily, Member 11b | +Inquiry |
| TNFRSF11B-210H | Active Recombinant Human TNFRSF11B | +Inquiry |
| TNFRSF11B-169H | Active Recombinant Human TNFRSF11B Protein, His tagged | +Inquiry |
| TNFRSF11B-19H | Recombinant Human TNFRSF11B, Fc Chimera | +Inquiry |
| ◆ Native Proteins | ||
| TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
| Tnfrsf11b-04M | Active Recombinant Mouse Tnfrsf11b Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF11B-1183CCL | Recombinant Cynomolgus TNFRSF11B cell lysate | +Inquiry |
| TNFRSF11B-2176HCL | Recombinant Human TNFRSF11B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF11B Products
Required fields are marked with *
My Review for All TNFRSF11B Products
Required fields are marked with *
