Recombinant Human TP53 protein, GST-tagged
Cat.No. : | TP53-010H |
Product Overview : | Recombinant Human TP53 protein, fused to GST-tagged, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Description : | This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants. |
Form : | 50mM Tris-HCl, pH 7.5, 150mM NaCl, 0.25mM DTT, 0.1mM EGTA, 0.1mM EDTA, 0.1mM PMSF, 25% glycerol. |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSLVPRGSEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD |
Purity : | >80 % |
Storage : | Long Term Storage at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.25 mg/ml |
Gene Name | TP53 tumor protein p53 [ Homo sapiens (human) ] |
Official Symbol | TP53 |
Synonyms | P53; BCC7; LFS1; BMFS5; TRP53 |
Gene ID | 7157 |
mRNA Refseq | NM_000546 |
Protein Refseq | NP_000537 |
MIM | 191170 |
UniProt ID | P04637 |
◆ Recombinant Proteins | ||
TP53-2548H | Recombinant Human TP53 protein(101-310 aa), N-MBP & C-His-tagged | +Inquiry |
TP53-1162CAF488 | Active Recombinant Cynomolgus TP53 Protein, Alexa Fluor 488 conjugated | +Inquiry |
TP53-2772H | Recombinant Human TP53 Protein, His-tagged | +Inquiry |
TP53-30571TH | Recombinant Human TP53, His-tagged | +Inquiry |
TP53-8275Z | Recombinant Zebrafish TP53 | +Inquiry |
◆ Native Proteins | ||
TP53-01HFL | Active Recombinant Full Length Human TP53 Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TP53-860HCL | Recombinant Human TP53 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TP53 Products
Required fields are marked with *
My Review for All TP53 Products
Required fields are marked with *