| Species : | Human | 
                                
                                    | Source : | Yeast | 
                                
                                    | Tag : | His | 
                                
                                    | Protein Length : | 891-1012 aa | 
                                
                                    | Description : | Transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes. Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone H3 that is both unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23' (H3K23ac). Has E3 protein-ubiquitin ligase activity. Promotes ubiquitination and proteasomal degradation of p53/TP53. Plays a role in the regulation of cell proliferation and apoptosis, at least in part via its effects on p53/TP53 levels. Up-regulates ligand-dependent transcription activation by AR, GCR/NR3C1, thyroid hormone receptor (TR) and ESR1. Modulates transcription activation by retinoic acid (RA) receptors, including RARA. Plays a role in regulating retinoic acid-dependent proliferation of hepatocytes. | 
                                
                                    | Form : | Tris-based buffer,50% glycerol | 
                                
                                    | Molecular Mass : | 16.5 kDa | 
                                
                                    | AA Sequence : | KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK | 
                                
                                    | Purity : | > 90% as determined by SDS-PAGE. | 
                                
                                    | Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. | 
                                
                                    | Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. | 
                                
                                    | Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |