Recombinant Human TTN protein, GST-tagged
Cat.No. : | TTN-301647H |
Product Overview : | Recombinant Human TTN protein(33738-33969 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 33738-33969 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | TTN titin [ Homo sapiens ] |
Official Symbol | TTN |
Synonyms | TTN; titin; cardiomyopathy, dilated 1G (autosomal dominant) , CMD1G; CMH9; CMPD4; FLJ32040; LGMD2J; MYLK5; TMD; connectin; rhabdomyosarcoma antigen MU-RMS-40.14; CMD1G; EOMFC; HMERF; FLJ26020; FLJ26409; FLJ34413; FLJ39564; FLJ43066; DKFZp451N061; |
Gene ID | 7273 |
mRNA Refseq | NM_001256850 |
Protein Refseq | NP_001243779 |
MIM | 188840 |
UniProt ID | Q8WZ42 |
◆ Recombinant Proteins | ||
TTN-25H | Recombinant Human TTN, GST-tagged | +Inquiry |
TTN-705H | Recombinant Human Titin | +Inquiry |
Ttn-507M | Recombinant Mouse Ttn Protein, His-tagged | +Inquiry |
TTN-301647H | Recombinant Human TTN protein, GST-tagged | +Inquiry |
TTN-26H | Recombinant Human TTN, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTN Products
Required fields are marked with *
My Review for All TTN Products
Required fields are marked with *