Recombinant Human UBE2C protein
Cat.No. : | UBE2C-04H |
Product Overview : | Recombinant Human UBE2C protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 191 |
Description : | Ubiquitin Conjugating Enzyme E2 C belongs to the ubiquitin-conjugating enzyme family and is encoded by the UBE2C gene in humans. The ubiquitin-conjugating enzymes, also known as E2 enzymes and more rarely as ubiquitin-carrier enzymes, take part in the second step in the ubiquitination reaction. In this reaction, E1 activates the ubiquitin by covalently attaching the molecule to its active site cysteine residue. The activated ubiquitin is then transferred to an E2 cysteine and then the E2 molecule binds E3 via a structurally conserved binding region. The UBE2C catalyzes the destruction of cyclins A and B in conjunction with the anaphase-promoting complex, and therefore, plays an important role in the control of the cell exit from mitosis. This activity is essential at the end of mitosis for the inactivation of their partner kinase Cdc2 and exit from mitosis into G1 of the next cell cycle. In addition, UBCH10 bears homology to yeast PAS2, a gene that is essential for biogenesis of peroxisomes. UBCH10 is useful for in vitro ubiquitinylation reactions. |
Form : | 0.2μm Filtered concentrated solution in 50 mM HEPES, pH 8.0, with 125 mM NaCl, 10 % Glycerol, 5 % Trehalose, 1 mM DTT. |
Molecular Mass : | Approximately 21.1 kDa, a single non-glycosylated polypeptide chain containing 179 amino acids (a.a.) of human UBE2C/UBCH10 and 12 a.a. vector sequence including 6 × His tag at N-terminus. |
AA Sequence : | MHHHHHHAMGIRMASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP |
Endotoxin : | Less than 1 EU/µg of rHuUBE2C, His as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening. |
Gene Name | UBE2C |
Official Symbol | UBE2C |
Synonyms | UBE2C; ubiquitin-conjugating enzyme E2C; ubiquitin-conjugating enzyme E2 C; UBCH10; ubiquitin-protein ligase C; ubiquitin carrier protein C; ubiquitin carrier protein E2-C; cyclin-selective ubiquitin carrier protein; mitotic-specific ubiquitin-conjugating enzyme; dJ447F3.2; |
Gene ID | 11065 |
mRNA Refseq | NM_007019 |
Protein Refseq | NP_008950 |
MIM | 605574 |
UniProt ID | O00762 |
◆ Recombinant Proteins | ||
UBE2C-118H | Recombinant Human UBE2C | +Inquiry |
UBE2C-04H | Recombinant Human UBE2C protein | +Inquiry |
UBE2C-3527H | Recombinant Human UBE2C, GST-tagged | +Inquiry |
UBE2C-815C | Recombinant Cynomolgus Monkey UBE2C Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2C-3585Z | Recombinant Zebrafish UBE2C | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2C-592HCL | Recombinant Human UBE2C 293 Cell Lysate | +Inquiry |
UBE2C-591HCL | Recombinant Human UBE2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBE2C Products
Required fields are marked with *
My Review for All UBE2C Products
Required fields are marked with *
0
Inquiry Basket