Recombinant Human UGT2B7 protein, His-tagged
Cat.No. : | UGT2B7-2431H |
Product Overview : | Recombinant Human UGT2B7 protein(25-351 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-351 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | KVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | UGT2B7 UDP glucuronosyltransferase 2 family, polypeptide B7 [ Homo sapiens ] |
Official Symbol | UGT2B7 |
Synonyms | UGT2B7; UDP glucuronosyltransferase 2 family, polypeptide B7; UDP glycosyltransferase 2 family, polypeptide B7; UDP-glucuronosyltransferase 2B7; UGT2B9; UDPGTh-2; UDPGT 2B7; 3,4-catechol estrogen specific; UDP glucuronosyltransferase 2B7; UDP-glucuronosyltransferase 2B9; 3,4-catechol estrogen-specific UDPGT; UDP-glucuronyltransferase, family 2, beta-7; UDPGTH2; UDPGT2B7; UDPGT 2B9; |
Gene ID | 7364 |
mRNA Refseq | NM_001074 |
Protein Refseq | NP_001065 |
MIM | 600068 |
UniProt ID | P16662 |
◆ Recombinant Proteins | ||
RFL26914RF | Recombinant Full Length Rat Udp-Glucuronosyltransferase 2B7(Ugt2B7) Protein, His-Tagged | +Inquiry |
UGT2B7-209H | Recombinant Human UGT2B7, GST-tagged | +Inquiry |
UGT2B7-2431H | Recombinant Human UGT2B7 protein, His-tagged | +Inquiry |
UGT2B7-6092R | Recombinant Rat UGT2B7 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL23893HF | Recombinant Full Length Human Udp-Glucuronosyltransferase 2B7(Ugt2B7) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UGT2B7 Products
Required fields are marked with *
My Review for All UGT2B7 Products
Required fields are marked with *