Recombinant Human UNC5C Protein, His Tagged
Cat.No. : | UNC5C-001H |
Product Overview : | Recombinant Human UNC5C Protein (40-376 aa) with His tag was expressed in HEK293. |
Availability | October 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 40-376 aa |
Description : | This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region. |
Molecular Mass : | 39 kDa |
AA Sequence : | AQDDDFFHELPETFPSDPPEPLPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQTAPDSDDHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 1 mg/mL by BCA |
Gene Name | UNC5C unc-5 netrin receptor C [ Homo sapiens (human) ] |
Official Symbol | UNC5C |
Synonyms | UNC5C; unc-5 homolog C (C. elegans); unc5 (C.elegans homolog) c; netrin receptor UNC5C; unc-5 homolog 3; protein unc-5 homolog 3; protein unc-5 homolog C; UNC5H3; |
Gene ID | 8633 |
mRNA Refseq | NM_003728 |
Protein Refseq | NP_003719 |
MIM | 603610 |
UniProt ID | O95185 |
◆ Recombinant Proteins | ||
UNC5C-5796Z | Recombinant Zebrafish UNC5C | +Inquiry |
UNC5C-6108R | Recombinant Rat UNC5C Protein, His (Fc)-Avi-tagged | +Inquiry |
UNC5C-9918M | Recombinant Mouse UNC5C Protein, His (Fc)-Avi-tagged | +Inquiry |
Unc5c-6839M | Recombinant Mouse Unc5c Protein, Myc/DDK-tagged | +Inquiry |
UNC5C-001H | Recombinant Human UNC5C Protein, His Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UNC5C Products
Required fields are marked with *
My Review for All UNC5C Products
Required fields are marked with *