Recombinant Human USP14 protein, His-tagged
Cat.No. : | USP14-3641H |
Product Overview : | Recombinant Human USP14 protein(1-294 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-294 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | USP14 ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) [ Homo sapiens ] |
Official Symbol | USP14 |
Synonyms | USP14; ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase); ubiquitin specific protease 14 (tRNA guanine transglycosylase); ubiquitin carboxyl-terminal hydrolase 14; TGT; ubiquitin thioesterase 14; deubiquitinating enzyme 14; ubiquitin thiolesterase 14; ubiquitin-specific processing protease 14; ubiquitin-specific-processing protease 14; tRNA-guanine transglycosylase, 60-kD subunit; ubiquitin specific protease 14 (tRNA-guanine transglycosylase); |
Gene ID | 9097 |
mRNA Refseq | NM_001037334 |
Protein Refseq | NP_001032411 |
MIM | 607274 |
UniProt ID | P54578 |
◆ Recombinant Proteins | ||
USP14-159H | Active Recombinant Human USP14, His-tagged | +Inquiry |
USP14-01H | Active Recombinant Human USP14 Protein | +Inquiry |
USP14-147H | Active Recombinant Human USP14, His-SUMO-tagged | +Inquiry |
USP14-692H | Recombinant Human USP14 | +Inquiry |
USP14-3617H | Recombinant Human USP14, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP14-471HCL | Recombinant Human USP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USP14 Products
Required fields are marked with *
My Review for All USP14 Products
Required fields are marked with *
0
Inquiry Basket