Recombinant Human USP7, His-tagged
Cat.No. : | USP7-29182TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 907-1102 of Human HAUSP / USP7 with N terminal His tag; 196 amino acids, 29kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Ubiquitin-specific-processing protease 7 (USP7) also known as ubiquitin carboxyl-terminal hydrolase 7 or herpesvirus-associated ubiquitin-specific protease (HAUSP) is an enzyme that in humans is encoded by the USP7 gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Widely expressed. Overexpressed in prostate cancer. |
Form : | Lyophilised:Reconstitute with 146 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVS YKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDK ENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMK RIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKD FEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKI HN |
Sequence Similarities : | Belongs to the peptidase C19 family.Contains 1 MATH domain. |
Gene Name : | USP7 ubiquitin specific peptidase 7 (herpes virus-associated) [ Homo sapiens ] |
Official Symbol : | USP7 |
Synonyms : | USP7; ubiquitin specific peptidase 7 (herpes virus-associated); HAUSP, ubiquitin specific protease 7 (herpes virus associated); ubiquitin carboxyl-terminal hydrolase 7; |
Gene ID : | 7874 |
mRNA Refseq : | NM_003470 |
Protein Refseq : | NP_003461 |
MIM : | 602519 |
Uniprot ID : | Q93009 |
Chromosome Location : | 16p13.3 |
Pathway : | FoxO family signaling, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; p53 pathway, organism-specific biosystem; |
Function : | cysteine-type endopeptidase activity; p53 binding; peptidase activity; protein C-terminus binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
USP7-0552H | Recombinant Human USP7 Protein (K208-E560), His tagged | +Inquiry |
Usp7-6882M | Recombinant Mouse Usp7 Protein, Myc/DDK-tagged | +Inquiry |
USP7-2329H | Recombinant Human USP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP7-6136R | Recombinant Rat USP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP7-677H | Recombinant Human USP7 Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
USP7-672HCL | Recombinant Human USP7 cell lysate | +Inquiry |
USP7-671HCL | Recombinant Human USP7 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Customer Reviews (3)
Write a reviewThe product's widespread recognition among researchers made it a preferred choice for many scientific studies.
Positive feedback from other labs and researchers confirmed its standing as a valuable research tool.
The product's respected reputation in the scientific community was a testament to its quality and effectiveness.
Q&As (7)
Ask a questionYes, USP7 interacts with various protein substrates, including p53, MDM2, and PTEN, influencing their stability and cellular functions.
Inhibitors targeting USP7 are being explored as potential cancer therapeutics, aiming to disrupt the stability of oncogenic proteins and inhibit cancer cell growth.
USP7 exhibits tissue-specific expression patterns, and its levels may vary in different tissues and cell types.
USP7 has been implicated in neurodegenerative diseases, and its dysregulation may contribute to protein aggregation and neuronal dysfunction.
Yes, USP7 undergoes post-translational modifications, including phosphorylation and ubiquitination, which can regulate its activity and stability.
USP7 regulates the p53 pathway by deubiquitinating and stabilizing p53, preventing its degradation and promoting its transcriptional activity.
Yes, USP7 plays a role in the immune response by regulating the stability of proteins involved in immune signaling pathways.
Ask a Question for All USP7 Products
Required fields are marked with *
My Review for All USP7 Products
Required fields are marked with *
Inquiry Basket