Recombinant Human USP7, His-tagged
| Cat.No. : | USP7-29182TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 907-1102 of Human HAUSP / USP7 with N terminal His tag; 196 amino acids, 29kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 907-1102 a.a. |
| Description : | Ubiquitin-specific-processing protease 7 (USP7) also known as ubiquitin carboxyl-terminal hydrolase 7 or herpesvirus-associated ubiquitin-specific protease (HAUSP) is an enzyme that in humans is encoded by the USP7 gene. |
| Conjugation : | HIS |
| Tissue specificity : | Widely expressed. Overexpressed in prostate cancer. |
| Form : | Lyophilised:Reconstitute with 146 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVS YKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDK ENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMK RIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKD FEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKI HN |
| Sequence Similarities : | Belongs to the peptidase C19 family.Contains 1 MATH domain. |
| Gene Name | USP7 ubiquitin specific peptidase 7 (herpes virus-associated) [ Homo sapiens ] |
| Official Symbol | USP7 |
| Synonyms | USP7; ubiquitin specific peptidase 7 (herpes virus-associated); HAUSP, ubiquitin specific protease 7 (herpes virus associated); ubiquitin carboxyl-terminal hydrolase 7; |
| Gene ID | 7874 |
| mRNA Refseq | NM_003470 |
| Protein Refseq | NP_003461 |
| MIM | 602519 |
| Uniprot ID | Q93009 |
| Chromosome Location | 16p13.3 |
| Pathway | FoxO family signaling, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; p53 pathway, organism-specific biosystem; |
| Function | cysteine-type endopeptidase activity; p53 binding; peptidase activity; protein C-terminus binding; protein binding; |
| ◆ Recombinant Proteins | ||
| USP7-4717H | Recombinant Human USP7 protein, His-SUMO & Myc-tagged | +Inquiry |
| USP7-457H | Recombinant Human USP7 protein, His-tagged | +Inquiry |
| USP7-924H | Recombinant Human USP7 protein(Lys208-Glu560), His&GST-tagged | +Inquiry |
| USP7-677H | Recombinant Human USP7 Protein, MYC/DDK-tagged | +Inquiry |
| USP7-6136R | Recombinant Rat USP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| USP7-315HKCL | Human USP7 Knockdown Cell Lysate | +Inquiry |
| USP7-672HCL | Recombinant Human USP7 cell lysate | +Inquiry |
| USP7-671HCL | Recombinant Human USP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP7 Products
Required fields are marked with *
My Review for All USP7 Products
Required fields are marked with *



