Recombinant Human USP7, His-tagged
Cat.No. : | USP7-29182TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 907-1102 of Human HAUSP / USP7 with N terminal His tag; 196 amino acids, 29kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 907-1102 a.a. |
Description : | Ubiquitin-specific-processing protease 7 (USP7) also known as ubiquitin carboxyl-terminal hydrolase 7 or herpesvirus-associated ubiquitin-specific protease (HAUSP) is an enzyme that in humans is encoded by the USP7 gene. |
Conjugation : | HIS |
Tissue specificity : | Widely expressed. Overexpressed in prostate cancer. |
Form : | Lyophilised:Reconstitute with 146 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVS YKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDK ENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMK RIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKD FEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKI HN |
Sequence Similarities : | Belongs to the peptidase C19 family.Contains 1 MATH domain. |
Gene Name | USP7 ubiquitin specific peptidase 7 (herpes virus-associated) [ Homo sapiens ] |
Official Symbol | USP7 |
Synonyms | USP7; ubiquitin specific peptidase 7 (herpes virus-associated); HAUSP, ubiquitin specific protease 7 (herpes virus associated); ubiquitin carboxyl-terminal hydrolase 7; |
Gene ID | 7874 |
mRNA Refseq | NM_003470 |
Protein Refseq | NP_003461 |
MIM | 602519 |
Uniprot ID | Q93009 |
Chromosome Location | 16p13.3 |
Pathway | FoxO family signaling, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; p53 pathway, organism-specific biosystem; |
Function | cysteine-type endopeptidase activity; p53 binding; peptidase activity; protein C-terminus binding; protein binding; |
◆ Recombinant Proteins | ||
USP7-677H | Recombinant Human USP7 Protein, MYC/DDK-tagged | +Inquiry |
USP7-319H | Recombinant Human USP7 protein, GST-tagged | +Inquiry |
USP7-6588H | Recombinant Human USP7 Protein (Gly202-Asn1102), N-His tagged | +Inquiry |
USP7-5967H | Recombinant Human USP7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
USP7-4717H | Recombinant Human USP7 protein, His-SUMO & Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP7-672HCL | Recombinant Human USP7 cell lysate | +Inquiry |
USP7-671HCL | Recombinant Human USP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP7 Products
Required fields are marked with *
My Review for All USP7 Products
Required fields are marked with *
0
Inquiry Basket