Recombinant Human WISP2 protein, GST-tagged
Cat.No. : | WISP2-4630H |
Product Overview : | Recombinant Human WISP2 protein(O76076)(1-250aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-250aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.3 kDa |
AA Sequence : | MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | WISP2 WNT1 inducible signaling pathway protein 2 [ Homo sapiens ] |
Official Symbol | WISP2 |
Synonyms | WISP2; WNT1 inducible signaling pathway protein 2; WNT1-inducible-signaling pathway protein 2; CCN5; CT58; CTGF L; WISP-2; CCN family member 5; wnt-1 signaling pathway protein 2; connective tissue growth factor-like protein; connective tissue growth factor-related protein 58; CTGF-L; |
Gene ID | 8839 |
mRNA Refseq | NM_003881 |
Protein Refseq | NP_003872 |
MIM | 603399 |
UniProt ID | O76076 |
◆ Recombinant Proteins | ||
WISP2-1754M | Recombinant Mouse WISP2 Protein (24-251 aa), His-tagged | +Inquiry |
WISP2-6251R | Recombinant Rat WISP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
WISP2-644H | Active Recombinant Human WNT1 Inducible Signaling Pathway Protein 2 | +Inquiry |
Wisp2-580M | Recombinant Mouse Wisp2 Protein, His-tagged | +Inquiry |
WISP2-6595R | Recombinant Rat WISP2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
WISP2-307HCL | Recombinant Human WISP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WISP2 Products
Required fields are marked with *
My Review for All WISP2 Products
Required fields are marked with *