Recombinant Human WISP2 protein, GST-tagged

Cat.No. : WISP2-4630H
Product Overview : Recombinant Human WISP2 protein(O76076)(1-250aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-250aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 51.3 kDa
AA Sequence : MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name WISP2 WNT1 inducible signaling pathway protein 2 [ Homo sapiens ]
Official Symbol WISP2
Synonyms WISP2; WNT1 inducible signaling pathway protein 2; WNT1-inducible-signaling pathway protein 2; CCN5; CT58; CTGF L; WISP-2; CCN family member 5; wnt-1 signaling pathway protein 2; connective tissue growth factor-like protein; connective tissue growth factor-related protein 58; CTGF-L;
Gene ID 8839
mRNA Refseq NM_003881
Protein Refseq NP_003872
MIM 603399
UniProt ID O76076

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WISP2 Products

Required fields are marked with *

My Review for All WISP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon