Recombinant Human WISP2 protein, GST-tagged
| Cat.No. : | WISP2-4630H |
| Product Overview : | Recombinant Human WISP2 protein(O76076)(1-250aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-250aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.3 kDa |
| AA Sequence : | MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | WISP2 WNT1 inducible signaling pathway protein 2 [ Homo sapiens ] |
| Official Symbol | WISP2 |
| Synonyms | WISP2; WNT1 inducible signaling pathway protein 2; WNT1-inducible-signaling pathway protein 2; CCN5; CT58; CTGF L; WISP-2; CCN family member 5; wnt-1 signaling pathway protein 2; connective tissue growth factor-like protein; connective tissue growth factor-related protein 58; CTGF-L; |
| Gene ID | 8839 |
| mRNA Refseq | NM_003881 |
| Protein Refseq | NP_003872 |
| MIM | 603399 |
| UniProt ID | O76076 |
| ◆ Recombinant Proteins | ||
| WISP2-6251R | Recombinant Rat WISP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| WISP2-1754M | Recombinant Mouse WISP2 Protein (24-251 aa), His-tagged | +Inquiry |
| Wisp2-580M | Recombinant Mouse Wisp2 Protein, His-tagged | +Inquiry |
| WISP2-644H | Active Recombinant Human WNT1 Inducible Signaling Pathway Protein 2 | +Inquiry |
| WISP2-4630H | Recombinant Human WISP2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WISP2-307HCL | Recombinant Human WISP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WISP2 Products
Required fields are marked with *
My Review for All WISP2 Products
Required fields are marked with *
