"WISP2" Related Products

Expand
Expand
Expand

Recombinant Mouse WISP2 Protein (24-251 aa), His-tagged

Cat.No. : WISP2-1754M
Product Overview : Recombinant Mouse WISP2 Protein (24-251 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
Description : May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity).
Source : Yeast
Species : Mouse
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 26.5 kDa
Protein length : 24-251 aa
AA Sequence : QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Figure :

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Gene Name : Wisp2 WNT1 inducible signaling pathway protein 2 [ Mus musculus ]
Official Symbol : WISP2
Synonyms : WISP2; CTGF-L; WISP-2; CCN family member 5; Ccn5; Crgr4; Ctgfl; Rcop1;
Gene ID : 22403
mRNA Refseq : NM_016873
Protein Refseq : NP_058569
UniProt ID : Q9Z0G4

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.