Recombinant Mouse WISP2 Protein (24-251 aa), His-tagged

Cat.No. : WISP2-1754M
Product Overview : Recombinant Mouse WISP2 Protein (24-251 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 24-251 aa
Description : May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 26.5 kDa
AA Sequence : QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Wisp2 WNT1 inducible signaling pathway protein 2 [ Mus musculus ]
Official Symbol WISP2
Synonyms WISP2; CTGF-L; WISP-2; CCN family member 5; Ccn5; Crgr4; Ctgfl; Rcop1;
Gene ID 22403
mRNA Refseq NM_016873
Protein Refseq NP_058569
UniProt ID Q9Z0G4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WISP2 Products

Required fields are marked with *

My Review for All WISP2 Products

Required fields are marked with *

0
cart-icon