Recombinant Mouse Arg1 protein, His-SUMO-tagged
| Cat.No. : | Arg1-4538M |
| Product Overview : | Recombinant Mouse Arg1 protein(Q61176)(1-323aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-323aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 50.8 kDa |
| AA Sequence : | MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Arg1 arginase, liver [ Mus musculus ] |
| Official Symbol | Arg1 |
| Synonyms | ARG1; arginase, liver; arginase-1; arginase I; type I arginase; arginase 1, liver; liver-type arginase; AI; PGIF; Arg-1; AI256583; |
| Gene ID | 11846 |
| mRNA Refseq | NM_007482 |
| Protein Refseq | NP_031508 |
| ◆ Recombinant Proteins | ||
| ARG1-4654H | Recombinant Human ARG1 protein, His-tagged | +Inquiry |
| Arg1-1132M | Recombinant Mouse Arg1 Protein, His-tagged | +Inquiry |
| ARG1-2961H | Recombinant Human ARG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Arg1-639M | Recombinant Mouse Arg1 Protein, MYC/DDK-tagged | +Inquiry |
| ARG1-2582H | Recombinant Human ARG1 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| Arg1-150R | Active Native Rat Arginase | +Inquiry |
| Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARG1-1869HCL | Recombinant Human ARG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Arg1 Products
Required fields are marked with *
My Review for All Arg1 Products
Required fields are marked with *
