Recombinant Mouse Arg1 protein, His-SUMO-tagged
Cat.No. : | Arg1-4538M |
Product Overview : | Recombinant Mouse Arg1 protein(Q61176)(1-323aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-323aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.8 kDa |
AA Sequence : | MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Arg1 arginase, liver [ Mus musculus ] |
Official Symbol | Arg1 |
Synonyms | ARG1; arginase, liver; arginase-1; arginase I; type I arginase; arginase 1, liver; liver-type arginase; AI; PGIF; Arg-1; AI256583; |
Gene ID | 11846 |
mRNA Refseq | NM_007482 |
Protein Refseq | NP_031508 |
◆ Recombinant Proteins | ||
ARG1-4221Z | Recombinant Zebrafish ARG1 | +Inquiry |
ARG1-0630H | Recombinant Human ARG1 Protein (Met1-Lys322), N-His-tagged | +Inquiry |
ARG1-2961H | Recombinant Human ARG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARG1-6425H | Recombinant Human ARG1 protein, His-tagged | +Inquiry |
Arg1-1524R | Recombinant Rat Arg1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
Arg1-150R | Active Native Rat Arginase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARG1-1869HCL | Recombinant Human ARG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Arg1 Products
Required fields are marked with *
My Review for All Arg1 Products
Required fields are marked with *
0
Inquiry Basket