Recombinant Human ARG1 protein, GST-tagged
Cat.No. : | ARG1-2546H |
Product Overview : | Recombinant Human ARG1 protein(P05089)(1-322aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-322aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 61.7 kDa |
AA Sequence : | MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ARG1 arginase, liver [ Homo sapiens ] |
Official Symbol | ARG1 |
Synonyms | ARG1; arginase, liver; arginase-1; type I arginase; liver-type arginase; |
Gene ID | 383 |
mRNA Refseq | NM_000045 |
Protein Refseq | NP_000036 |
MIM | 608313 |
UniProt ID | P05089 |
◆ Recombinant Proteins | ||
ARG1-3913H | Recombinant Human ARG1 protein, His-tagged | +Inquiry |
ARG1-250HFL | Active Recombinant Full Length Human ARG1 Protein, C-Flag-tagged | +Inquiry |
ARG1-2190H | Active Recombinant Human ARG1 protein, His-tagged | +Inquiry |
ARG1-0629H | Recombinant Human ARG1 Protein (Met1-lys322), C-His-tagged | +Inquiry |
ARG1-243R | Recombinant Rabbit ARG1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
Arg1-150R | Active Native Rat Arginase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARG1-1869HCL | Recombinant Human ARG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARG1 Products
Required fields are marked with *
My Review for All ARG1 Products
Required fields are marked with *