"Bag3" Related Products

Expand
Expand
Expand

Recombinant Mouse Bag3 protein, His-tagged

Cat.No.: Bag3-33M
Product Overview: Recombinant Mouse Bag3(2-577aa) fused with His tag was expressed in Yeast.
Source: Yeast
Species: Mouse
Tag: His
Form: Tris-based buffer,50% glycerol
Molecular Mass: 63.7kD
AA Sequence: SAATQSPMMQMASGNGASDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPEGPKDTASSANGPSRDGS RLLPIREGHPIYPQLRPGYIPIPVLHEGSENRQPHLFHAYSQPGVQRFRTEAAAATPQRSQSPLRGGMTEAAQTD KQCGQMPATATTAAAQPPTAHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYIPIPVIHEQNITRPA AQPSFHQAQKTHYPAQQGEYQPQQPVYHKIQGDDWEPRPLRAASPFRSPVRGASSREGSPARSGTPVHCPSPIRV HTVVDRPQPMTHREPPPVTQPENKPESKPGPAGPDLPPGHIPIQVIRREADSKPVSQKSPPPAEKVEVKVSSAPI PCPSPSPAPSAVPSPPKNVAAEQKAAPSPAPAEPAAPKSGEAETPPKHPGVLKVEAILEKVQGLEQAVDSFEGKK TDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEAEQPL QEIMGAVVADKDKKGPENKDPQTESQQLEAKAATPPNPSNPADSAGNLVAP
Purity: >90% ( SDS-PAGE )
Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.
Gene Name: Bag3 BCL2-associated athanogene 3 [ Mus musculus ]
Official Symbol: Bag3
Synonyms: BAG3; BCL2-associated athanogene 3; BAG family molecular chaperone regulator 3; BAG-3; Bcl-2-binding protein Bis; bcl-2-associated athanogene 3; Bcl-2-interacting death suppressor; Bis; mg638; AA407278;
Gene ID: 29810
mRNA Refseq: NM_013863
Protein Refseq: NP_038891
MIM:
UniProt ID:
Chromosome Location: 7; 7 F3
Function: chaperone binding; protein binding; protein complex binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.