"Bag3" Related Products

Expand
Expand
Expand

Recombinant Mouse Bag3 protein, His-tagged

Cat.No. : Bag3-33M
Product Overview : Recombinant Mouse Bag3(2-577aa) fused with His tag was expressed in Yeast.
Source : Yeast
Species : Mouse
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 63.7kD
AA Sequence : SAATQSPMMQMASGNGASDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPEGPKDTASSANGPSRDGS RLLPIREGHPIYPQLRPGYIPIPVLHEGSENRQPHLFHAYSQPGVQRFRTEAAAATPQRSQSPLRGGMTEAAQTD KQCGQMPATATTAAAQPPTAHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYIPIPVIHEQNITRPA AQPSFHQAQKTHYPAQQGEYQPQQPVYHKIQGDDWEPRPLRAASPFRSPVRGASSREGSPARSGTPVHCPSPIRV HTVVDRPQPMTHREPPPVTQPENKPESKPGPAGPDLPPGHIPIQVIRREADSKPVSQKSPPPAEKVEVKVSSAPI PCPSPSPAPSAVPSPPKNVAAEQKAAPSPAPAEPAAPKSGEAETPPKHPGVLKVEAILEKVQGLEQAVDSFEGKK TDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEAEQPL QEIMGAVVADKDKKGPENKDPQTESQQLEAKAATPPNPSNPADSAGNLVAP
Purity : >90% ( SDS-PAGE )
Storage : Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.
Gene Name : Bag3 BCL2-associated athanogene 3 [ Mus musculus ]
Official Symbol : Bag3
Synonyms : BAG3; BCL2-associated athanogene 3; BAG family molecular chaperone regulator 3; BAG-3; Bcl-2-binding protein Bis; bcl-2-associated athanogene 3; Bcl-2-interacting death suppressor; Bis; mg638; AA407278;
Gene ID : 29810
mRNA Refseq : NM_013863
Protein Refseq : NP_038891
MIM :
UniProt ID :
Chromosome Location : 7; 7 F3
Function : chaperone binding; protein binding; protein complex binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.