Recombinant Mouse CD28 Protein, Fc-tagged

• Cat.No.: CD28-625M
• Product Overview: Recombinant Mouse CD28 protein with Fc tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Fc
• Protein Length: 218
• Description: Enables protein kinase binding activity. Acts upstream of or within several processes, including positive regulation of immune response; positive regulation of intracellular signal transduction; and regulation of lymphocyte activation. Located in external side of plasma membrane and immunological synapse. Human ortholog(s) of this gene implicated in multiple sclerosis and type 1 diabetes mellitus. Orthologous to human CD28 (CD28 molecule).
• Form: Lyophilized
• Molecular Mass: 41.7 kDa
• AA Sequence: MTLRLLFLALNFFSVQVTENKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLFWALVVVAGVLFCYGLLVTVALCVIWTNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Cd28 CD28 antigen [ Mus musculus (house mouse) ]
• Official Symbol: CD28
• Synonyms: CD28; CD28 antigen; T-cell-specific surface glycoprotein CD28
• Gene ID: 12487
• mRNA Refseq: NM_007642
• Protein Refseq: NP_031668
• UniProt ID: P31041