Recombinant Mouse CD28 Protein, Fc-tagged
Cat.No. : | CD28-625M |
Product Overview : | Recombinant Mouse CD28 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 218 |
Description : | Enables protein kinase binding activity. Acts upstream of or within several processes, including positive regulation of immune response; positive regulation of intracellular signal transduction; and regulation of lymphocyte activation. Located in external side of plasma membrane and immunological synapse. Human ortholog(s) of this gene implicated in multiple sclerosis and type 1 diabetes mellitus. Orthologous to human CD28 (CD28 molecule). |
Form : | Lyophilized |
Molecular Mass : | 41.7 kDa |
AA Sequence : | MTLRLLFLALNFFSVQVTENKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLFWALVVVAGVLFCYGLLVTVALCVIWTNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Cd28 CD28 antigen [ Mus musculus (house mouse) ] |
Official Symbol | CD28 |
Synonyms | CD28; CD28 antigen; T-cell-specific surface glycoprotein CD28; |
Gene ID | 12487 |
mRNA Refseq | NM_007642 |
Protein Refseq | NP_031668 |
UniProt ID | P31041 |
◆ Recombinant Proteins | ||
CD28-378H | Active Recombinant Human CD28, HIgG1 Fc-tagged | +Inquiry |
RFL13001FF | Recombinant Full Length Cat T-Cell-Specific Surface Glycoprotein Cd28(Cd28) Protein, His-Tagged | +Inquiry |
CD28-339M | Recombinant Mouse CD28 protein, Fc-tagged | +Inquiry |
CD28-321H | Recombinant Human CD28 Protein | +Inquiry |
Cd28-4008M | Recombinant Mouse Cd28 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD28-2002MCL | Recombinant Mouse CD28 cell lysate | +Inquiry |
CD28-2013HCL | Recombinant Human CD28 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD28 Products
Required fields are marked with *
My Review for All CD28 Products
Required fields are marked with *
0
Inquiry Basket