Recombinant Mouse FCER1A Full Length Transmembrane protein (24-250 aa), His-SUMO-tagged
| Cat.No. : | FCER1A-2710M |
| Product Overview : | Recombinant Mouse FCER1A Protein (24-250 aa) is produced by in vitro E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 24-250aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.7kDa |
| AA Sequence : | ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Fcer1a Fc receptor, IgE, high affinity I, alpha polypeptide [ Mus musculus ] |
| Official Symbol | FCER1A |
| Synonyms | FCER1A; Fc receptor, IgE, high affinity I, alpha polypeptide; high affinity immunoglobulin epsilon receptor subunit alpha; fc-epsilon RI-alpha; igE Fc receptor subunit alpha; FcERI; Fce1a; Fcr-5; fcepsilonri; |
| Gene ID | 14125 |
| mRNA Refseq | NM_010184 |
| Protein Refseq | NP_034314 |
| ◆ Recombinant Proteins | ||
| FCER1A-567H | Recombinant Human FCER1A Protein (Met1-Gln205) | +Inquiry |
| RFL15030RF | Recombinant Full Length Rat High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha(Fcer1A) Protein, His-Tagged | +Inquiry |
| Fcer1a-2376M | Recombinant Mouse Fcer1a protein, His-SUMO-tagged | +Inquiry |
| FCER1A-2930H | Recombinant Human FCER1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| FCER1A-204H | Recombinant Human FCER1A, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCER1A-1394HCL | Recombinant Human FCER1A cell lysate | +Inquiry |
| FCER1A-1389MCL | Recombinant Mouse FCER1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER1A Products
Required fields are marked with *
My Review for All FCER1A Products
Required fields are marked with *
